YUSN - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YUSN - Uncharacterized protein YusN

UniProt:	O32180	Sequences: MNQQNQKISNPQTPVPTTSEMNDRDFVNELLTTEKYMTTAYCTALHEFSHESLYQDIQSIFDESQKAQRKLYDLMFQYGWYSVEAEDSQKLQQSYQKFQQTIQQQSPYQQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	110 (103)
Sequences:	135 (104)
Seq/√Len:	10.2

BACSU - YUSN

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
84_E	90_K	4.674	1.00
13_T	80_W	2.904	0.92
21_M	26_F	2.574	0.86
27_V	74_L	2.555	0.86
7_K	82_S	2.522	0.85
12_Q	17_T	2.501	0.84
72_Y	83_V	2.449	0.83
78_Y	106_S	2.093	0.72
46_H	65_Q	2.035	0.69
17_T	28_N	2.004	0.68
58_Q	62_D	1.953	0.66
56_D	91_L	1.940	0.66
19_S	101_T	1.859	0.62
12_Q	23_D	1.722	0.56
50_H	92_Q	1.721	0.56
58_Q	106_S	1.682	0.54
22_N	80_W	1.600	0.50
101_T	105_Q	1.569	0.49
45_L	65_Q	1.540	0.48
10_N	76_F	1.526	0.47
37_M	46_H	1.380	0.40
15_V	72_Y	1.377	0.40
66_K	70_K	1.352	0.39
45_L	57_I	1.336	0.38
41_Y	54_Y	1.330	0.38
50_H	91_L	1.324	0.38
97_K	101_T	1.303	0.37
22_N	30_L	1.278	0.36
103_Q	106_S	1.256	0.35
34_E	57_I	1.205	0.33
69_R	80_W	1.201	0.33
91_L	100_Q	1.187	0.32
53_L	86_E	1.173	0.31
12_Q	97_K	1.172	0.31
68_Q	73_D	1.171	0.31
45_L	68_Q	1.166	0.31
77_Q	80_W	1.160	0.31
34_E	67_A	1.150	0.31
24_R	98_F	1.149	0.30
23_D	91_L	1.143	0.30
27_V	52_S	1.102	0.29
19_S	24_R	1.083	0.28
15_V	42_C	1.074	0.28
38_T	64_S	1.072	0.28
24_R	101_T	1.066	0.27
44_A	85_A	1.055	0.27
17_T	101_T	1.047	0.27
39_T	61_F	1.044	0.27
34_E	71_L	1.041	0.26
50_H	89_Q	1.034	0.26
41_Y	46_H	1.024	0.26
27_V	62_D	1.018	0.26
58_Q	66_K	1.005	0.25
74_L	77_Q	1.004	0.25
66_K	86_E	0.998	0.25
60_I	64_S	0.985	0.24
27_V	86_E	0.973	0.24
61_F	70_K	0.972	0.24
23_D	30_L	0.967	0.24
8_I	85_A	0.959	0.24
37_M	61_F	0.956	0.23
57_I	103_Q	0.950	0.23
14_P	94_S	0.948	0.23
84_E	91_L	0.945	0.23
12_Q	104_Q	0.931	0.23
73_D	98_F	0.914	0.22
16_P	41_Y	0.909	0.22
44_A	69_R	0.893	0.21
24_R	97_K	0.879	0.21
61_F	90_K	0.876	0.21
30_L	58_Q	0.873	0.21
8_I	74_L	0.866	0.21
36_Y	40_A	0.866	0.21
95_Y	104_Q	0.864	0.21
101_T	106_S	0.858	0.20
28_N	101_T	0.856	0.20
37_M	65_Q	0.852	0.20
49_S	69_R	0.843	0.20
22_N	60_I	0.843	0.20
56_D	60_I	0.830	0.20
20_E	87_D	0.821	0.19
95_Y	99_Q	0.805	0.19
58_Q	88_S	0.799	0.19
8_I	76_F	0.789	0.18
4_Q	82_S	0.783	0.18
39_T	46_H	0.783	0.18
14_P	103_Q	0.778	0.18
36_Y	107_P	0.769	0.18
70_K	78_Y	0.762	0.18
91_L	95_Y	0.756	0.17
89_Q	96_Q	0.756	0.17
9_S	103_Q	0.749	0.17
21_M	44_A	0.748	0.17
22_N	61_F	0.747	0.17
19_S	100_Q	0.746	0.17
26_F	32_T	0.745	0.17
44_A	49_S	0.737	0.17
38_T	63_E	0.737	0.17
39_T	103_Q	0.725	0.17
9_S	71_L	0.719	0.17
24_R	28_N	0.719	0.17
74_L	98_F	0.717	0.16
28_N	71_L	0.710	0.16
45_L	50_H	0.706	0.16
16_P	68_Q	0.705	0.16
17_T	97_K	0.696	0.16
27_V	94_S	0.695	0.16
38_T	42_C	0.691	0.16
9_S	34_E	0.686	0.16
42_C	61_F	0.686	0.16
46_H	50_H	0.684	0.16
9_S	30_L	0.680	0.16
84_E	99_Q	0.676	0.15
14_P	98_F	0.669	0.15
56_D	63_E	0.664	0.15
58_Q	73_D	0.664	0.15
23_D	53_L	0.663	0.15
71_L	93_Q	0.641	0.15
59_S	77_Q	0.631	0.14
7_K	45_L	0.630	0.14
18_T	42_C	0.603	0.14
33_T	98_F	0.599	0.14
8_I	40_A	0.586	0.13
14_P	37_M	0.586	0.13
14_P	66_K	0.584	0.13
21_M	67_A	0.584	0.13
86_E	90_K	0.576	0.13
11_P	63_E	0.572	0.13
85_A	103_Q	0.572	0.13
34_E	59_S	0.570	0.13
62_D	66_K	0.567	0.13
9_S	82_S	0.557	0.13
97_K	105_Q	0.557	0.13
98_F	101_T	0.557	0.13
34_E	41_Y	0.552	0.13
33_T	36_Y	0.552	0.13
54_Y	65_Q	0.551	0.13
30_L	80_W	0.547	0.13
18_T	61_F	0.544	0.13
16_P	104_Q	0.543	0.12
60_I	82_S	0.542	0.12
38_T	46_H	0.536	0.12
24_R	36_Y	0.534	0.12
13_T	48_F	0.532	0.12
18_T	21_M	0.527	0.12
42_C	65_Q	0.524	0.12
21_M	107_P	0.522	0.12
24_R	105_Q	0.514	0.12
9_S	78_Y	0.508	0.12
38_T	54_Y	0.508	0.12
41_Y	69_R	0.506	0.12
40_A	83_V	0.505	0.12
27_V	80_W	0.502	0.12
48_F	83_V	0.500	0.12

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2rbdA	4	0.7909	99.3	0.744	Contact Map
2miiA	1	0.9273	5.8	0.957	Contact Map
2fji1	1	0.9182	5.5	0.957	Contact Map
4etrA	1	0.5909	4.9	0.958	Contact Map
4bedA	3	0.3364	4.6	0.959	Contact Map
3k92A	5	0.5727	4.3	0.959	Contact Map
4bwcA	1	0.6364	3.3	0.961	Contact Map
1ji5A	6	0.6818	2.2	0.965	Contact Map
3rruA	1	0.6364	2.1	0.965	Contact Map
4o9lA	1	0.5455	2.1	0.965	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.