SUFU - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SUFU - Zinc-dependent sulfurtransferase SufU

UniProt:	O32163	Sequences: MSFNANLDTLYRQVIMDHYKNPRNKGVLNDSIVVDMNNPTCGDRIRLTMKLDGDIVEDAKFEGEGCSISMASASMMTQAIKGKDIETALSMSKIFSDMMQGKEYDDSIDLGDIEALQGVSKFPARIKCATLSWKALEKGVAKEEGGN	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	147 (137)
Sequences:	1728 (1065)
Seq/√Len:	91.0

ECOLI - ISCU
BACSU - SUFU
HALSA - Q9HMM5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
52_D	57_E	4.656	1.00
83_K	87_T	3.859	1.00
24_N	81_K	3.523	1.00
84_D	87_T	3.371	1.00
75_M	116_L	3.333	1.00
26_G	60_K	2.457	1.00
23_R	78_Q	2.420	1.00
50_K	58_D	2.389	1.00
35_D	46_R	2.383	1.00
59_A	80_I	2.311	1.00
50_K	57_E	2.241	1.00
27_V	48_T	2.120	1.00
28_L	60_K	2.103	1.00
56_V	88_A	1.993	1.00
73_A	132_S	1.942	1.00
35_D	44_R	1.935	1.00
48_T	60_K	1.934	1.00
58_D	81_K	1.927	1.00
24_N	77_T	1.918	1.00
27_V	62_E	1.910	1.00
30_D	50_K	1.870	1.00
51_L	85_I	1.813	1.00
89_L	137_E	1.713	1.00
97_D	102_K	1.665	1.00
80_I	136_L	1.647	1.00
90_S	94_I	1.590	1.00
80_I	88_A	1.536	1.00
31_S	50_K	1.536	1.00
36_M	135_A	1.523	1.00
85_I	89_L	1.513	1.00
93_K	97_D	1.498	1.00
18_H	74_S	1.493	1.00
33_V	48_T	1.479	1.00
68_I	129_A	1.425	0.99
55_I	84_D	1.401	0.99
89_L	141_A	1.376	0.99
34_V	47_L	1.335	0.99
61_F	77_T	1.331	0.99
85_I	140_V	1.304	0.99
12_R	16_M	1.301	0.99
51_L	54_D	1.296	0.99
49_M	59_A	1.289	0.99
54_D	86_E	1.271	0.99
90_S	109_D	1.266	0.99
14_V	115_A	1.174	0.98
24_N	58_D	1.158	0.97
96_S	134_K	1.152	0.97
32_I	139_G	1.150	0.97
37_N	44_R	1.148	0.97
87_T	90_S	1.110	0.97
56_V	136_L	1.076	0.96
43_D	128_C	1.072	0.96
94_I	109_D	1.071	0.96
76_M	133_W	1.067	0.96
137_E	141_A	1.057	0.96
89_L	140_V	1.051	0.95
59_A	77_T	1.050	0.95
99_M	126_I	1.050	0.95
74_S	77_T	1.049	0.95
34_V	138_K	1.041	0.95
26_G	62_E	1.037	0.95
103_E	106_D	1.022	0.95
17_D	23_R	1.017	0.95
23_R	74_S	1.010	0.94
27_V	60_K	0.998	0.94
44_R	64_E	0.988	0.94
31_S	51_L	0.984	0.94
94_I	107_S	0.971	0.93
136_L	140_V	0.968	0.93
25_K	70_M	0.952	0.92
51_L	140_V	0.947	0.92
106_D	109_D	0.943	0.92
22_P	74_S	0.939	0.92
119_V	129_A	0.929	0.91
25_K	63_G	0.912	0.91
40_T	121_K	0.900	0.90
86_E	89_L	0.899	0.90
79_A	91_M	0.897	0.90
98_M	104_Y	0.891	0.90
12_R	20_K	0.889	0.90
49_M	56_V	0.887	0.89
36_M	67_S	0.881	0.89
18_H	22_P	0.877	0.89
23_R	77_T	0.874	0.89
15_I	68_I	0.865	0.88
27_V	33_V	0.863	0.88
24_N	78_Q	0.857	0.88
33_V	46_R	0.847	0.87
36_M	134_K	0.844	0.87
95_F	99_M	0.840	0.87
65_G	127_K	0.833	0.86
38_N	127_K	0.832	0.86
25_K	62_E	0.816	0.85
113_I	133_W	0.811	0.85
83_K	91_M	0.809	0.85
72_S	133_W	0.807	0.85
56_V	80_I	0.806	0.84
32_I	143_E	0.802	0.84
28_L	48_T	0.801	0.84
14_V	17_D	0.801	0.84
90_S	93_K	0.800	0.84
11_Y	42_G	0.798	0.84
54_D	85_I	0.787	0.83
118_G	121_K	0.785	0.83
71_A	116_L	0.781	0.83
39_P	42_G	0.778	0.82
24_N	74_S	0.773	0.82
96_S	137_E	0.768	0.81
38_N	65_G	0.765	0.81
91_M	109_D	0.757	0.81
9_T	13_Q	0.755	0.80
99_M	120_S	0.740	0.79
126_I	135_A	0.736	0.79
109_D	114_E	0.736	0.79
51_L	139_G	0.733	0.78
18_H	75_M	0.726	0.78
98_M	117_Q	0.724	0.78
65_G	69_S	0.724	0.78
72_S	95_F	0.718	0.77
67_S	75_M	0.715	0.77
94_I	97_D	0.712	0.76
88_A	136_L	0.707	0.76
36_M	40_T	0.706	0.76
117_Q	120_S	0.704	0.76
93_K	137_E	0.698	0.75
30_D	48_T	0.696	0.75
92_S	96_S	0.694	0.75
138_K	142_K	0.690	0.74
96_S	130_T	0.689	0.74
51_L	143_E	0.685	0.74
75_M	113_I	0.677	0.73
49_M	136_L	0.677	0.73
38_N	43_D	0.670	0.72
57_E	82_G	0.667	0.72
123_P	127_K	0.659	0.71
72_S	83_K	0.655	0.70
70_M	130_T	0.654	0.70
46_R	62_E	0.654	0.70
97_D	103_E	0.654	0.70
118_G	122_F	0.653	0.70
89_L	93_K	0.650	0.70
92_S	137_E	0.650	0.70
97_D	106_D	0.648	0.69
8_D	121_K	0.644	0.69
102_K	120_S	0.641	0.69
34_V	135_A	0.635	0.68
42_G	133_W	0.632	0.67
58_D	61_F	0.632	0.67
65_G	128_C	0.632	0.67
22_P	25_K	0.630	0.67
61_F	69_S	0.627	0.67
9_T	102_K	0.620	0.66
38_N	128_C	0.620	0.66
43_D	65_G	0.619	0.66
126_I	130_T	0.619	0.66
101_G	120_S	0.617	0.66
18_H	115_A	0.617	0.66
69_S	128_C	0.615	0.65
94_I	104_Y	0.614	0.65
43_D	69_S	0.611	0.65
40_T	64_E	0.600	0.63
118_G	123_P	0.597	0.63
26_G	58_D	0.596	0.63
94_I	105_D	0.595	0.63
37_N	70_M	0.590	0.62
93_K	100_Q	0.590	0.62
38_N	69_S	0.583	0.61
7_L	122_F	0.582	0.61
119_V	124_A	0.581	0.61
76_M	80_I	0.580	0.61
93_K	141_A	0.575	0.60
49_M	139_G	0.571	0.60
38_N	42_G	0.570	0.60
130_T	134_K	0.568	0.59
11_Y	39_P	0.567	0.59
91_M	95_F	0.564	0.59
105_D	114_E	0.563	0.59
11_Y	122_F	0.562	0.58
7_L	37_N	0.561	0.58
120_S	123_P	0.558	0.58
97_D	101_G	0.558	0.58
100_Q	126_I	0.554	0.57
30_D	58_D	0.552	0.57
76_M	132_S	0.545	0.56
11_Y	123_P	0.543	0.56
86_E	90_S	0.539	0.55
31_S	58_D	0.539	0.55
72_S	75_M	0.538	0.55
14_V	126_I	0.532	0.54
34_V	142_K	0.531	0.54
103_E	107_S	0.528	0.54
98_M	110_L	0.527	0.54
84_D	88_A	0.526	0.54
99_M	130_T	0.525	0.53
70_M	135_A	0.525	0.53
52_D	55_I	0.525	0.53
94_I	106_D	0.519	0.53
17_D	21_N	0.518	0.52
83_K	111_G	0.515	0.52
31_S	52_D	0.507	0.51
19_Y	67_S	0.505	0.51
105_D	117_Q	0.504	0.51
11_Y	38_N	0.503	0.50
31_S	53_G	0.500	0.50
47_L	136_L	0.500	0.50
124_A	127_K	0.500	0.50

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1xjsA	1	1	100	0.152	Contact Map
1su0B	1	0.9252	100	0.169	Contact Map
2qq4A	5	0.932	100	0.196	Contact Map
2z7eA	5	0.8367	100	0.322	Contact Map
3lvlA	1	0.8095	100	0.331	Contact Map
4eb5C	1	0.8095	100	0.342	Contact Map
3g0mA	1	0.8231	79.9	0.909	Contact Map
1vqzA	1	0.7619	58.6	0.922	Contact Map
3a7rA	1	0.7823	52.7	0.925	Contact Map
2e5aA	1	0.6939	51.8	0.926	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0063 seconds.