XDHE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

XDHE - Probable xanthine dehydrogenase subunit E

UniProt:	O32143	Sequences: MDIKEAGPFPVKKEQFRMTVNGQAWEVAAVPTTHLSDLLRKEFQLTGTKVSCGIGRCGACSILIDGKLANACMTMAYQADGHSITTIEGLQKEELDMCQTAFLEEGGFQCGYCTPGMIIALKALFRETPQPSDKDIEEGLAGNLCRCTGYGGIMRSACRIRRELNGGRRESGF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	173 (149)
Sequences:	6864 (4054)
Seq/√Len:	332.1

ECOLI - XDHD YAGT XDHC
BACSU - XDHE
SULSO - Q97VI6 Q97W14

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
105_E	159_R	3.891	1.00
133_D	158_C	3.735	1.00
33_T	42_E	3.195	1.00
96_D	122_K	2.709	1.00
136_I	158_C	2.544	1.00
19_T	83_S	2.511	1.00
47_G	87_I	2.501	1.00
132_S	135_D	2.501	1.00
27_V	38_L	2.404	1.00
65_D	82_H	2.317	1.00
100_T	104_E	2.275	1.00
105_E	155_R	2.249	1.00
17_R	26_E	2.002	1.00
121_L	157_A	2.001	1.00
55_G	73_M	1.923	1.00
36_S	50_V	1.905	1.00
61_S	68_L	1.896	1.00
98_C	118_I	1.874	1.00
64_I	69_A	1.860	1.00
45_L	48_T	1.831	1.00
104_E	159_R	1.825	1.00
122_K	126_R	1.814	1.00
19_T	24_A	1.808	1.00
38_L	76_A	1.782	1.00
63_L	119_I	1.780	1.00
64_I	74_T	1.771	1.00
33_T	38_L	1.745	1.00
87_I	118_I	1.734	1.00
17_R	24_A	1.680	1.00
128_T	135_D	1.673	1.00
137_E	154_M	1.671	1.00
50_V	53_G	1.558	1.00
15_Q	28_A	1.514	1.00
100_T	163_E	1.488	1.00
47_G	88_E	1.471	1.00
75_M	78_Q	1.432	1.00
98_C	122_K	1.432	1.00
21_N	88_E	1.382	1.00
21_N	45_L	1.367	1.00
68_L	123_A	1.339	1.00
95_L	99_Q	1.330	1.00
61_S	119_I	1.315	1.00
140_L	157_A	1.312	1.00
63_L	123_A	1.297	1.00
91_Q	95_L	1.265	1.00
35_L	62_I	1.259	1.00
20_V	43_F	1.254	1.00
133_D	155_R	1.253	1.00
85_T	89_G	1.249	1.00
64_I	84_I	1.248	1.00
29_A	76_A	1.236	1.00
15_Q	26_E	1.233	1.00
18_M	25_W	1.224	1.00
117_M	140_L	1.222	1.00
123_A	127_E	1.221	1.00
124_L	139_G	1.218	1.00
107_G	156_S	1.214	1.00
159_R	163_E	1.208	1.00
63_L	122_K	1.207	1.00
102_F	114_T	1.187	1.00
128_T	131_P	1.172	1.00
74_T	79_A	1.139	1.00
35_L	84_I	1.135	1.00
69_A	74_T	1.135	1.00
131_P	161_R	1.116	1.00
64_I	82_H	1.113	1.00
98_C	121_L	1.109	1.00
151_G	155_R	1.091	1.00
98_C	160_I	1.084	1.00
120_A	142_G	1.066	1.00
20_V	25_W	1.058	1.00
16_F	80_D	1.033	1.00
91_Q	94_E	1.010	1.00
133_D	137_E	0.999	1.00
96_D	99_Q	0.996	1.00
48_T	87_I	0.995	1.00
152_G	155_R	0.993	1.00
38_L	43_F	0.992	1.00
64_I	79_A	0.984	1.00
35_L	79_A	0.969	1.00
90_L	122_K	0.967	1.00
36_S	48_T	0.959	1.00
30_V	33_T	0.952	1.00
29_A	42_E	0.920	1.00
68_L	120_A	0.912	1.00
133_D	154_M	0.908	1.00
107_G	114_T	0.897	1.00
116_G	143_N	0.896	1.00
45_L	88_E	0.893	1.00
34_H	37_D	0.888	1.00
67_K	127_E	0.884	1.00
94_E	100_T	0.884	1.00
27_V	43_F	0.875	1.00
20_V	45_L	0.874	1.00
125_F	161_R	0.859	1.00
91_Q	99_Q	0.852	1.00
85_T	126_R	0.840	1.00
65_D	83_S	0.825	1.00
104_E	163_E	0.823	1.00
22_G	25_W	0.822	1.00
90_L	118_I	0.820	1.00
98_C	125_F	0.819	1.00
63_L	85_T	0.808	1.00
154_M	158_C	0.805	1.00
79_A	82_H	0.797	1.00
62_I	71_A	0.791	1.00
22_G	83_S	0.788	1.00
101_A	159_R	0.783	1.00
102_F	121_L	0.777	1.00
39_L	62_I	0.776	1.00
34_H	50_V	0.775	1.00
121_L	140_L	0.773	1.00
159_R	162_R	0.768	1.00
97_M	160_I	0.765	1.00
117_M	149_G	0.764	1.00
127_E	139_G	0.762	1.00
102_F	107_G	0.761	1.00
106_G	149_G	0.757	1.00
106_G	148_T	0.754	1.00
74_T	78_Q	0.751	0.99
117_M	153_I	0.750	0.99
134_K	138_E	0.750	0.99
134_K	137_E	0.750	0.99
102_F	118_I	0.749	0.99
124_L	131_P	0.742	0.99
17_R	80_D	0.735	0.99
36_S	51_S	0.734	0.99
53_G	56_R	0.732	0.99
46_T	115_P	0.724	0.99
101_A	160_I	0.722	0.99
131_P	139_G	0.721	0.99
37_D	50_V	0.699	0.99
18_M	27_V	0.699	0.99
68_L	139_G	0.698	0.99
95_L	103_L	0.696	0.99
124_L	136_I	0.694	0.99
102_F	117_M	0.693	0.99
136_I	154_M	0.692	0.99
120_A	139_G	0.690	0.99
93_E	97_M	0.684	0.99
29_A	38_L	0.682	0.99
21_N	89_G	0.680	0.99
155_R	159_R	0.678	0.99
105_E	156_S	0.674	0.99
135_D	139_G	0.673	0.99
33_T	41_K	0.673	0.99
32_T	77_Y	0.670	0.99
102_F	108_F	0.669	0.99
128_T	139_G	0.669	0.99
38_L	42_E	0.667	0.99
34_H	75_M	0.666	0.99
117_M	143_N	0.666	0.99
18_M	38_L	0.663	0.99
39_L	43_F	0.660	0.99
160_I	163_E	0.660	0.99
124_L	128_T	0.654	0.99
124_L	129_P	0.650	0.99
93_E	96_D	0.649	0.99
70_N	74_T	0.649	0.99
125_F	160_I	0.648	0.99
89_G	95_L	0.646	0.98
108_F	114_T	0.642	0.98
37_D	41_K	0.635	0.98
46_T	49_K	0.630	0.98
125_F	131_P	0.628	0.98
33_T	76_A	0.627	0.98
63_L	68_L	0.626	0.98
39_L	48_T	0.625	0.98
125_F	128_T	0.624	0.98
57_C	60_C	0.620	0.98
106_G	152_G	0.619	0.98
16_F	76_A	0.619	0.98
92_K	95_L	0.617	0.98
52_C	57_C	0.614	0.98
90_L	119_I	0.613	0.98
85_T	122_K	0.608	0.98
117_M	142_G	0.605	0.98
16_F	29_A	0.605	0.98
49_K	115_P	0.603	0.98
52_C	60_C	0.602	0.98
66_G	83_S	0.600	0.98
50_V	56_R	0.600	0.98
49_K	70_N	0.596	0.97
25_W	38_L	0.589	0.97
39_L	46_T	0.586	0.97
27_V	42_E	0.583	0.97
34_H	54_I	0.583	0.97
74_T	82_H	0.582	0.97
54_I	70_N	0.580	0.97
61_S	120_A	0.578	0.97
120_A	143_N	0.572	0.97
93_E	99_Q	0.571	0.97
148_T	151_G	0.571	0.97
63_L	126_R	0.569	0.97
142_G	150_Y	0.568	0.97
66_G	82_H	0.564	0.96
56_R	70_N	0.563	0.96
41_K	46_T	0.559	0.96
103_L	108_F	0.558	0.96
48_T	88_E	0.548	0.96
47_G	99_Q	0.546	0.96
50_V	70_N	0.546	0.96
76_A	79_A	0.543	0.96
90_L	96_D	0.543	0.96
136_I	157_A	0.543	0.96
49_K	106_G	0.542	0.96
20_V	39_L	0.541	0.96
35_L	74_T	0.533	0.95
95_L	100_T	0.530	0.95
119_I	139_G	0.527	0.95
125_F	129_P	0.527	0.95
61_S	143_N	0.520	0.94
60_C	72_C	0.518	0.94
18_M	80_D	0.517	0.94
52_C	72_C	0.516	0.94
130_Q	162_R	0.513	0.94
117_M	148_T	0.513	0.94
20_V	84_I	0.512	0.94
18_M	79_A	0.510	0.94
57_C	72_C	0.508	0.94
32_T	75_M	0.508	0.94
53_G	70_N	0.503	0.93
31_P	77_Y	0.501	0.93
50_V	112_Y	0.500	0.93

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3uncA	2	0.8902	100	0.093	Contact Map
3zyvA	3	0.896	100	0.102	Contact Map
3nvwA	1	0.8728	100	0.14	Contact Map
2w3sA	1	0.896	100	0.146	Contact Map
1dgjA	1	0.9306	100	0.16	Contact Map
4usaA	2	0.9306	100	0.172	Contact Map
1n62A	1	0.9191	100	0.223	Contact Map
3hrdD	1	0.9191	100	0.232	Contact Map
1rm6C	1	0.9017	100	0.282	Contact Map
1t3qA	1	0.9306	100	0.287	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.