HIUH - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

HIUH - 5-hydroxyisourate hydrolase

UniProt:	O32142	Sequences: MGKLTTHILDLTCGKPAANVKIGLKRLGESIMKEVYTNNDGRVDVPLLAGEELMSGEYVMEFHAGDYFASKNMNAADQPFLTIVTVRFQLADPDAHYHIPLLLSPFGYQVYRGS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	114 (107)
Sequences:	1689 (1100)
Seq/√Len:	106.4

ECOLI - HIUH
BACSU - HIUH

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
8_I	20_V	3.474	1.00
38_N	44_D	3.296	1.00
92_D	95_A	3.269	1.00
59_V	87_R	2.825	1.00
23_G	63_H	2.757	1.00
17_A	20_V	2.645	1.00
11_L	107_G	2.539	1.00
63_H	66_D	2.403	1.00
31_I	34_E	2.243	1.00
25_K	61_E	2.234	1.00
23_G	34_E	2.167	1.00
21_K	63_H	2.165	1.00
35_V	43_V	2.135	1.00
78_Q	91_A	1.976	1.00
29_E	59_V	1.953	1.00
61_E	83_I	1.845	1.00
21_K	36_Y	1.844	1.00
80_F	99_I	1.820	1.00
64_A	84_V	1.752	1.00
23_G	61_E	1.749	1.00
23_G	31_I	1.743	1.00
21_K	34_E	1.587	1.00
10_D	13_C	1.499	1.00
59_V	85_T	1.491	1.00
22_I	60_M	1.490	1.00
13_C	71_K	1.483	1.00
69_A	79_P	1.430	1.00
40_D	114_S	1.424	1.00
61_E	85_T	1.413	1.00
12_T	107_G	1.407	1.00
19_N	36_Y	1.367	1.00
57_E	89_Q	1.351	1.00
25_K	31_I	1.347	1.00
18_A	39_N	1.284	0.99
25_K	59_V	1.252	0.99
11_L	81_L	1.238	0.99
62_F	101_L	1.234	0.99
68_F	103_L	1.214	0.99
66_D	69_A	1.211	0.99
60_M	99_I	1.191	0.99
35_V	45_V	1.190	0.99
78_Q	89_Q	1.161	0.99
104_S	107_G	1.125	0.98
40_D	102_L	1.118	0.98
6_T	60_M	1.111	0.98
69_A	77_D	1.085	0.98
53_L	58_Y	1.076	0.98
63_H	83_I	1.029	0.97
64_A	103_L	1.020	0.97
83_I	87_R	0.986	0.96
20_V	103_L	0.985	0.96
69_A	82_T	0.973	0.96
3_K	50_G	0.950	0.95
26_R	29_E	0.944	0.95
84_V	101_L	0.927	0.94
72_N	77_D	0.922	0.94
88_F	109_Q	0.921	0.94
62_F	99_I	0.907	0.94
64_A	82_T	0.878	0.92
65_G	69_A	0.871	0.92
21_K	66_D	0.866	0.92
82_T	85_T	0.864	0.92
16_P	114_S	0.862	0.92
20_V	64_A	0.848	0.91
33_K	52_E	0.848	0.91
27_L	31_I	0.833	0.90
8_I	37_T	0.829	0.90
6_T	107_G	0.823	0.90
72_N	89_Q	0.813	0.89
101_L	108_Y	0.810	0.89
25_K	29_E	0.807	0.89
15_K	95_A	0.794	0.88
79_P	103_L	0.787	0.88
22_I	37_T	0.786	0.88
26_R	54_M	0.784	0.87
90_L	93_P	0.770	0.86
49_A	52_E	0.761	0.86
43_V	107_G	0.757	0.86
8_I	105_P	0.752	0.85
9_L	42_R	0.748	0.85
81_L	85_T	0.744	0.85
26_R	56_G	0.743	0.84
22_I	43_V	0.742	0.84
80_F	106_F	0.739	0.84
12_T	104_S	0.737	0.84
22_I	83_I	0.722	0.83
4_L	53_L	0.720	0.83
66_D	70_S	0.720	0.83
64_A	81_L	0.719	0.82
3_K	49_A	0.718	0.82
40_D	101_L	0.705	0.81
91_A	95_A	0.703	0.81
37_T	43_V	0.698	0.81
11_L	109_Q	0.683	0.79
65_G	79_P	0.670	0.78
55_S	93_P	0.665	0.77
81_L	110_V	0.665	0.77
47_L	50_G	0.655	0.76
4_L	48_L	0.655	0.76
36_Y	39_N	0.653	0.76
7_H	42_R	0.653	0.76
51_E	54_M	0.652	0.76
5_T	47_L	0.650	0.76
42_R	111_Y	0.648	0.75
53_L	56_G	0.647	0.75
103_L	107_G	0.645	0.75
32_M	58_Y	0.641	0.75
5_T	12_T	0.638	0.74
58_Y	67_Y	0.636	0.74
57_E	87_R	0.636	0.74
100_P	109_Q	0.635	0.74
40_D	99_I	0.634	0.74
8_I	62_F	0.632	0.74
5_T	102_L	0.626	0.73
27_L	59_V	0.623	0.73
5_T	96_H	0.623	0.73
26_R	30_S	0.618	0.72
20_V	37_T	0.617	0.72
3_K	47_L	0.613	0.71
81_L	86_V	0.610	0.71
106_F	109_Q	0.609	0.71
3_K	96_H	0.605	0.70
11_L	40_D	0.598	0.70
62_F	80_F	0.597	0.69
26_R	32_M	0.595	0.69
29_E	87_R	0.595	0.69
10_D	53_L	0.594	0.69
8_I	104_S	0.593	0.69
6_T	99_I	0.593	0.69
5_T	52_E	0.587	0.68
71_K	77_D	0.586	0.68
99_I	102_L	0.580	0.67
13_C	106_F	0.579	0.67
68_F	106_F	0.578	0.67
23_G	83_I	0.576	0.67
15_K	18_A	0.572	0.66
28_G	51_E	0.568	0.66
68_F	84_V	0.567	0.65
24_L	60_M	0.564	0.65
7_H	98_H	0.560	0.64
69_A	72_N	0.558	0.64
54_M	94_D	0.549	0.63
10_D	71_K	0.549	0.63
20_V	67_Y	0.545	0.62
5_T	51_E	0.542	0.62
47_L	60_M	0.540	0.62
22_I	34_E	0.540	0.62
43_V	49_A	0.532	0.61
3_K	60_M	0.521	0.59
53_L	86_V	0.520	0.59
64_A	68_F	0.520	0.59
111_Y	114_S	0.519	0.59
20_V	68_F	0.516	0.58
65_G	89_Q	0.515	0.58
36_Y	54_M	0.514	0.58
57_E	83_I	0.512	0.58
52_E	94_D	0.510	0.57
38_N	108_Y	0.502	0.56
11_L	17_A	0.500	0.56
28_G	65_G	0.500	0.56

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4q14A	2	0.9912	100	0.053	Contact Map
2h0eA	4	0.9912	100	0.07	Contact Map
3iwvA	4	0.9561	100	0.086	Contact Map
2g2nA	5	0.9561	100	0.101	Contact Map
3qvaA	4	0.9211	100	0.109	Contact Map
1f86A	4	0.9474	100	0.167	Contact Map
1oo2A	4	0.9561	100	0.169	Contact Map
4pweA	4	0.9474	100	0.178	Contact Map
4zjhA	1	0.6053	98.7	0.775	Contact Map
4zjgA	1	0.5789	95.5	0.867	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0057 seconds.