YUNG - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YUNG - Uncharacterized protein YunG

UniProt:	O32136	Sequences: MEHVKYILKQSWSRHSSSKWTEECPSCGQCGVTALVIQDHFGGTIFKTRVDESWHFYNSINGVVYDFTSEQFQAPIEYQHIPSSREEAFLDTNEEQYQHLREAFSRHMNSISEET	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	115 (106)
Sequences:	126 (67)
Seq/√Len:	6.5

BACSU - YUNG

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
34_A	89_F	3.005	0.81
64_V	80_H	2.676	0.72
83_S	86_E	2.203	0.57
56_F	76_I	2.200	0.56
80_H	85_R	2.071	0.52
31_G	93_N	2.036	0.50
21_T	37_I	2.005	0.49
17_S	92_T	1.863	0.44
39_D	97_Y	1.825	0.43
11_S	23_E	1.708	0.38
35_L	56_F	1.655	0.37
48_T	91_D	1.652	0.37
15_H	95_E	1.642	0.36
4_V	41_F	1.636	0.36
44_T	83_S	1.631	0.36
50_V	53_S	1.598	0.35
29_Q	34_A	1.593	0.35
7_I	101_R	1.548	0.33
37_I	95_E	1.538	0.33
14_R	22_E	1.503	0.32
17_S	36_V	1.497	0.31
16_S	41_F	1.454	0.30
36_V	45_I	1.451	0.30
49_R	94_E	1.450	0.30
5_K	65_Y	1.389	0.28
51_D	99_H	1.379	0.28
45_I	92_T	1.362	0.27
15_H	34_A	1.355	0.27
38_Q	76_I	1.347	0.27
11_S	46_F	1.333	0.26
49_R	90_L	1.318	0.26
36_V	92_T	1.316	0.26
26_S	48_T	1.309	0.26
37_I	105_S	1.280	0.25
24_C	80_H	1.275	0.25
22_E	61_N	1.265	0.25
31_G	67_F	1.259	0.24
92_T	97_Y	1.229	0.24
30_C	72_F	1.210	0.23
34_A	53_S	1.208	0.23
13_S	26_S	1.196	0.23
17_S	48_T	1.172	0.22
32_V	88_A	1.171	0.22
4_V	107_H	1.158	0.22
37_I	62_G	1.158	0.22
32_V	96_Q	1.145	0.21
3_H	23_E	1.135	0.21
54_W	93_N	1.132	0.21
8_L	68_T	1.127	0.21
5_K	38_Q	1.127	0.21
83_S	92_T	1.122	0.21
5_K	90_L	1.090	0.20
45_I	83_S	1.084	0.20
5_K	61_N	1.074	0.20
49_R	54_W	1.073	0.20
29_Q	96_Q	1.059	0.19
28_G	96_Q	1.056	0.19
35_L	76_I	1.030	0.19
4_V	79_Q	1.022	0.18
54_W	92_T	1.011	0.18
50_V	77_E	1.000	0.18
15_H	25_P	0.998	0.18
17_S	83_S	0.987	0.18
32_V	91_D	0.979	0.18
3_H	63_V	0.977	0.18
40_H	70_E	0.967	0.17
23_E	94_E	0.964	0.17
4_V	95_E	0.954	0.17
24_C	53_S	0.941	0.17
34_A	50_V	0.940	0.17
25_P	64_V	0.937	0.17
10_Q	99_H	0.935	0.17
25_P	48_T	0.930	0.17
11_S	81_I	0.926	0.16
45_I	56_F	0.920	0.16
10_Q	51_D	0.912	0.16
74_A	87_E	0.900	0.16
13_S	48_T	0.900	0.16
4_V	34_A	0.897	0.16
31_G	54_W	0.874	0.15
56_F	65_Y	0.866	0.15
85_R	88_A	0.865	0.15
10_Q	106_R	0.862	0.15
31_G	92_T	0.860	0.15
16_S	99_H	0.838	0.15
37_I	82_P	0.833	0.15
15_H	29_Q	0.824	0.14
11_S	67_F	0.823	0.14
53_S	70_E	0.822	0.14
57_Y	88_A	0.821	0.14
50_V	74_A	0.820	0.14
32_V	35_L	0.819	0.14
31_G	38_Q	0.815	0.14
63_V	103_A	0.812	0.14
86_E	92_T	0.808	0.14
16_S	53_S	0.807	0.14
48_T	88_A	0.794	0.14
23_E	51_D	0.790	0.14
37_I	61_N	0.789	0.14
38_Q	75_P	0.782	0.14
38_Q	97_Y	0.775	0.14
25_P	85_R	0.769	0.14
46_F	91_D	0.757	0.13
83_S	93_N	0.741	0.13
35_L	48_T	0.737	0.13
94_E	98_Q	0.736	0.13
17_S	26_S	0.727	0.13
88_A	91_D	0.727	0.13
39_D	68_T	0.724	0.13
76_I	98_Q	0.722	0.13
41_F	82_P	0.709	0.13
59_S	63_V	0.673	0.12
57_Y	82_P	0.673	0.12
16_S	36_V	0.672	0.12
48_T	96_Q	0.669	0.12
7_I	107_H	0.662	0.12
38_Q	70_E	0.660	0.12
17_S	87_E	0.658	0.12
67_F	93_N	0.656	0.12
79_Q	87_E	0.655	0.12
8_L	40_H	0.654	0.12
16_S	90_L	0.654	0.12
51_D	74_A	0.653	0.12
3_H	70_E	0.653	0.12
26_S	31_G	0.651	0.12
79_Q	102_E	0.651	0.12
35_L	47_K	0.649	0.12
19_K	75_P	0.645	0.12
7_I	81_I	0.644	0.11
18_S	35_L	0.644	0.11
16_S	70_E	0.639	0.11
7_I	41_F	0.638	0.11
32_V	85_R	0.633	0.11
47_K	96_Q	0.630	0.11
35_L	45_I	0.628	0.11
10_Q	107_H	0.616	0.11
10_Q	28_G	0.614	0.11
25_P	60_I	0.607	0.11
65_Y	75_P	0.604	0.11
8_L	32_V	0.600	0.11
21_T	59_S	0.599	0.11
34_A	77_E	0.590	0.11
18_S	56_F	0.587	0.11
26_S	35_L	0.582	0.11
9_K	107_H	0.582	0.11
81_I	84_S	0.582	0.11
52_E	80_H	0.573	0.10
3_H	25_P	0.566	0.10
36_V	78_Y	0.553	0.10
75_P	101_R	0.551	0.10
13_S	35_L	0.549	0.10
91_D	97_Y	0.542	0.10
52_E	91_D	0.534	0.10
21_T	105_S	0.532	0.10
3_H	9_K	0.522	0.10
37_I	103_A	0.519	0.10
54_W	83_S	0.514	0.10
65_Y	76_I	0.506	0.10
14_R	106_R	0.500	0.09

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2mduA	1	0.2522	34.7	0.939	Contact Map
3zyyX	2	0.9826	30.9	0.94	Contact Map
4jleA	4	0.5391	20.7	0.945	Contact Map
1vbgA	2	0.8435	20.2	0.945	Contact Map
2v0xA	2	0.4435	14	0.949	Contact Map
4ghnA	1	0.5826	13	0.95	Contact Map
1kblA	2	0.9478	12.6	0.95	Contact Map
4dcdA	1	0.5478	9.8	0.952	Contact Map
1xdnA	1	0.7565	9.5	0.953	Contact Map
3dorA	2	0.4348	9.4	0.953	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.