YUTD - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YUTD - Uncharacterized protein YutD

UniProt:	O32127	Sequences: MILIQNAEFELVHNFKDGFNEEAFKARYSDILNKYDYIVGDWGYGQLRLKGFFDDQNQKATFETKISTLDEYIYEYCNFGCAYFVLKRIRK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	91 (87)
Sequences:	373 (223)
Seq/√Len:	23.9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
66_I	69_L	4.536	1.00
55_D	67_S	4.257	1.00
69_L	85_V	4.154	1.00
54_D	87_K	3.070	1.00
77_C	81_C	2.469	0.98
14_N	17_D	2.402	0.98
43_G	78_N	2.335	0.98
4_I	24_F	2.203	0.97
39_V	85_V	2.180	0.96
18_G	42_W	2.091	0.95
9_F	33_N	1.956	0.94
23_A	42_W	1.774	0.90
11_L	19_F	1.736	0.89
28_Y	33_N	1.687	0.87
34_K	53_F	1.648	0.86
19_F	43_G	1.630	0.85
27_R	46_Q	1.528	0.81
21_E	25_K	1.492	0.79
15_F	70_D	1.451	0.78
57_N	60_A	1.401	0.75
24_F	86_L	1.359	0.73
19_F	31_I	1.325	0.71
42_W	82_A	1.280	0.68
61_T	64_T	1.251	0.66
10_E	87_K	1.243	0.66
5_Q	15_F	1.237	0.65
37_Y	54_D	1.193	0.62
62_F	65_K	1.179	0.61
25_K	70_D	1.175	0.61
37_Y	71_E	1.139	0.59
35_Y	53_F	1.121	0.57
13_H	16_K	1.104	0.56
14_N	28_Y	1.094	0.56
55_D	65_K	1.066	0.54
11_L	17_D	1.023	0.51
76_Y	80_G	0.998	0.49
29_S	59_K	0.993	0.48
65_K	73_I	0.980	0.48
33_N	86_L	0.972	0.47
32_L	35_Y	0.963	0.46
19_F	24_F	0.958	0.46
31_I	43_G	0.957	0.46
7_A	88_R	0.953	0.46
3_L	53_F	0.950	0.45
9_F	88_R	0.939	0.45
3_L	8_E	0.931	0.44
55_D	64_T	0.917	0.43
33_N	50_K	0.913	0.43
11_L	20_N	0.898	0.42
20_N	71_E	0.897	0.42
9_F	44_Y	0.888	0.41
66_I	85_V	0.887	0.41
6_N	14_N	0.878	0.40
5_Q	30_D	0.862	0.39
30_D	88_R	0.856	0.39
11_L	86_L	0.853	0.39
29_S	57_N	0.819	0.36
45_G	87_K	0.809	0.36
20_N	50_K	0.805	0.36
27_R	79_F	0.781	0.34
61_T	65_K	0.780	0.34
38_I	49_L	0.774	0.34
33_N	37_Y	0.768	0.33
21_E	88_R	0.762	0.33
28_Y	88_R	0.761	0.33
29_S	32_L	0.759	0.33
50_K	69_L	0.757	0.32
53_F	61_T	0.748	0.32
21_E	67_S	0.745	0.32
27_R	75_E	0.739	0.31
58_Q	64_T	0.739	0.31
23_A	26_A	0.737	0.31
22_E	26_A	0.733	0.31
4_I	85_V	0.714	0.30
50_K	72_Y	0.712	0.30
37_Y	61_T	0.702	0.29
54_D	58_Q	0.698	0.29
31_I	71_E	0.686	0.28
38_I	70_D	0.685	0.28
62_F	74_Y	0.685	0.28
55_D	60_A	0.685	0.28
4_I	9_F	0.677	0.28
3_L	19_F	0.664	0.27
19_F	33_N	0.658	0.27
32_L	68_T	0.650	0.26
42_W	66_I	0.650	0.26
23_A	45_G	0.637	0.25
70_D	86_L	0.629	0.25
39_V	73_I	0.628	0.25
5_Q	14_N	0.627	0.25
27_R	69_L	0.624	0.25
34_K	75_E	0.623	0.25
19_F	81_C	0.618	0.24
34_K	46_Q	0.616	0.24
57_N	81_C	0.612	0.24
31_I	57_N	0.608	0.24
50_K	64_T	0.604	0.24
30_D	57_N	0.598	0.23
46_Q	79_F	0.590	0.23
59_K	65_K	0.581	0.23
5_Q	16_K	0.579	0.23
66_I	80_G	0.579	0.23
35_Y	74_Y	0.576	0.22
70_D	74_Y	0.576	0.22
30_D	81_C	0.573	0.22
76_Y	82_A	0.567	0.22
38_I	44_Y	0.565	0.22
6_N	10_E	0.563	0.22
3_L	17_D	0.559	0.22
17_D	56_Q	0.557	0.21
34_K	81_C	0.556	0.21
11_L	14_N	0.554	0.21
65_K	76_Y	0.554	0.21
54_D	68_T	0.551	0.21
6_N	45_G	0.546	0.21
38_I	50_K	0.544	0.21
43_G	81_C	0.540	0.21
11_L	22_E	0.538	0.21
43_G	46_Q	0.536	0.20
8_E	70_D	0.531	0.20
18_G	59_K	0.529	0.20
40_G	44_Y	0.528	0.20
31_I	46_Q	0.524	0.20
19_F	74_Y	0.522	0.20
5_Q	33_N	0.517	0.20
29_S	34_K	0.514	0.19
35_Y	79_F	0.511	0.19
85_V	88_R	0.506	0.19
60_A	64_T	0.504	0.19
75_E	83_Y	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2kl5A	1	1	100	0.006	Contact Map
2c7pA	1	0.8681	10.9	0.938	Contact Map
3c8fA	1	0.4615	9.7	0.939	Contact Map
3ubtY	2	0.8681	5	0.946	Contact Map
4cvdA	1	0.4615	4.3	0.948	Contact Map
3iuoA	4	0.6044	4.1	0.949	Contact Map
2glfA	4	0.4176	3.4	0.95	Contact Map
3g7uA	1	0.8352	3.3	0.951	Contact Map
3qv2A	1	0.8901	3.1	0.951	Contact Map
2qrvA	2	0.9341	2.8	0.953	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.