YUTE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YUTE - UPF0331 protein YutE

UniProt:	O32126	Sequences: MYFVDRSKIEKTLGFFEHQLALFDSQTDWQSEIGELALQRIGHLLIECILDTGNDMIDGFIMRDPGSYDDIMDILVDEKVVTEKEGDELKKLIAYRKTLVQQYLLADSGELYRLIKAHQTALQDFPKRIRSYLETELGPVSAFK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	144 (140)
Sequences:	269 (218)
Seq/√Len:	18.5

BACSU - YUTE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
10_E	130_R	4.186	1.00
17_E	126_P	4.034	1.00
91_K	117_A	3.624	1.00
107_D	110_E	3.220	0.99
62_M	80_V	2.903	0.99
19_Q	36_L	2.785	0.98
17_E	130_R	2.587	0.97
76_V	86_G	2.575	0.97
4_V	13_L	2.555	0.97
99_L	111_L	2.490	0.96
24_D	123_Q	2.276	0.94
89_L	122_L	2.206	0.93
126_P	130_R	2.188	0.93
85_E	128_R	2.128	0.92
26_Q	29_W	1.939	0.87
6_R	137_L	1.908	0.86
13_L	52_T	1.861	0.85
31_S	34_G	1.858	0.85
62_M	78_E	1.843	0.84
131_S	135_T	1.737	0.81
61_I	74_I	1.667	0.78
21_A	109_G	1.651	0.77
38_L	108_S	1.646	0.77
11_K	105_L	1.637	0.76
95_Y	114_L	1.620	0.76
9_I	71_I	1.619	0.76
20_L	122_L	1.552	0.72
5_D	73_D	1.550	0.72
16_F	45_L	1.502	0.70
69_D	93_I	1.494	0.69
52_T	72_M	1.436	0.66
36_L	81_V	1.429	0.66
54_N	65_P	1.397	0.64
10_E	17_E	1.396	0.64
101_Q	139_P	1.388	0.64
62_M	138_G	1.375	0.63
8_K	12_T	1.362	0.62
6_R	138_G	1.349	0.61
52_T	108_S	1.337	0.61
84_K	110_E	1.328	0.60
87_D	122_L	1.295	0.58
6_R	62_M	1.263	0.56
23_F	29_W	1.245	0.55
15_F	44_L	1.241	0.55
3_F	65_P	1.230	0.54
3_F	54_N	1.223	0.54
109_G	120_T	1.222	0.54
80_V	132_Y	1.198	0.52
82_T	129_I	1.189	0.52
49_I	122_L	1.171	0.50
89_L	100_V	1.167	0.50
23_F	41_I	1.166	0.50
134_E	139_P	1.165	0.50
16_F	36_L	1.142	0.49
19_Q	22_L	1.141	0.49
12_T	66_G	1.140	0.48
52_T	129_I	1.129	0.48
59_G	100_V	1.112	0.47
50_L	55_D	1.109	0.47
82_T	128_R	1.105	0.46
61_I	77_D	1.073	0.44
20_L	102_Q	1.070	0.44
97_K	132_Y	1.068	0.44
42_G	45_L	1.012	0.41
25_S	84_K	1.004	0.40
75_L	133_L	0.995	0.40
75_L	106_A	0.995	0.40
47_E	122_L	0.989	0.39
7_S	83_E	0.973	0.38
11_K	104_L	0.970	0.38
62_M	71_I	0.963	0.38
38_L	65_P	0.962	0.38
41_I	139_P	0.962	0.38
88_E	121_A	0.961	0.38
84_K	124_D	0.956	0.37
62_M	132_Y	0.949	0.37
84_K	88_E	0.936	0.36
31_S	45_L	0.936	0.36
18_H	111_L	0.931	0.36
13_L	17_E	0.930	0.36
95_Y	102_Q	0.930	0.36
14_G	131_S	0.926	0.36
10_E	101_Q	0.922	0.35
4_V	104_L	0.919	0.35
85_E	129_I	0.919	0.35
61_I	132_Y	0.911	0.35
24_D	127_K	0.906	0.34
98_T	106_A	0.899	0.34
73_D	90_K	0.888	0.33
27_T	109_G	0.883	0.33
19_Q	44_L	0.870	0.32
59_G	74_I	0.841	0.31
27_T	105_L	0.835	0.31
44_L	103_Y	0.823	0.30
83_E	101_Q	0.820	0.30
34_G	99_L	0.819	0.30
36_L	103_Y	0.815	0.30
130_R	137_L	0.808	0.29
59_G	137_L	0.803	0.29
9_I	32_E	0.801	0.29
5_D	123_Q	0.801	0.29
33_I	124_D	0.798	0.29
12_T	48_C	0.798	0.29
14_G	133_L	0.793	0.28
37_A	115_I	0.792	0.28
97_K	101_Q	0.774	0.27
102_Q	110_E	0.768	0.27
21_A	84_K	0.761	0.27
18_H	82_T	0.757	0.27
59_G	62_M	0.756	0.27
109_G	134_E	0.747	0.26
65_P	75_L	0.744	0.26
76_V	112_Y	0.741	0.26
87_D	135_T	0.740	0.26
116_K	119_Q	0.739	0.26
3_F	42_G	0.737	0.26
59_G	133_L	0.737	0.26
20_L	92_L	0.735	0.26
21_A	27_T	0.730	0.25
18_H	69_D	0.716	0.25
73_D	93_I	0.712	0.24
12_T	103_Y	0.708	0.24
62_M	79_K	0.706	0.24
60_F	73_D	0.706	0.24
88_E	131_S	0.705	0.24
33_I	101_Q	0.703	0.24
81_V	129_I	0.702	0.24
82_T	127_K	0.700	0.24
51_D	58_D	0.697	0.24
18_H	30_Q	0.695	0.24
56_M	138_G	0.693	0.24
18_H	32_E	0.689	0.23
77_D	133_L	0.688	0.23
44_L	101_Q	0.681	0.23
47_E	125_F	0.679	0.23
55_D	89_L	0.676	0.23
22_L	36_L	0.669	0.23
44_L	85_E	0.667	0.22
81_V	134_E	0.651	0.22
88_E	117_A	0.650	0.22
105_L	117_A	0.649	0.22
81_V	89_L	0.648	0.22
86_G	90_K	0.647	0.22
87_D	113_R	0.647	0.22
50_L	101_Q	0.644	0.21
55_D	132_Y	0.641	0.21
15_F	75_L	0.641	0.21
21_A	102_Q	0.636	0.21
124_D	127_K	0.622	0.21
44_L	67_S	0.622	0.21
77_D	81_V	0.621	0.21
30_Q	128_R	0.615	0.20
77_D	138_G	0.610	0.20
15_F	73_D	0.608	0.20
11_K	83_E	0.606	0.20
29_W	81_V	0.596	0.20
45_L	49_I	0.595	0.19
12_T	67_S	0.593	0.19
48_C	66_G	0.589	0.19
27_T	82_T	0.589	0.19
90_K	103_Y	0.588	0.19
82_T	87_D	0.585	0.19
109_G	117_A	0.583	0.19
35_E	82_T	0.582	0.19
92_L	108_S	0.580	0.19
5_D	10_E	0.578	0.19
30_Q	106_A	0.576	0.19
20_L	45_L	0.576	0.19
22_L	125_F	0.575	0.19
49_I	92_L	0.572	0.19
51_D	64_D	0.571	0.19
58_D	64_D	0.571	0.19
17_E	65_P	0.571	0.19
83_E	114_L	0.571	0.19
50_L	56_M	0.569	0.18
88_E	125_F	0.563	0.18
24_D	129_I	0.561	0.18
2_Y	53_G	0.555	0.18
101_Q	140_V	0.555	0.18
17_E	54_N	0.555	0.18
77_D	132_Y	0.551	0.18
73_D	77_D	0.550	0.18
69_D	90_K	0.549	0.18
19_Q	55_D	0.548	0.18
9_I	136_E	0.548	0.18
7_S	104_L	0.547	0.18
65_P	118_H	0.546	0.18
89_L	140_V	0.544	0.18
122_L	132_Y	0.544	0.18
53_G	60_F	0.542	0.17
60_F	74_I	0.541	0.17
85_E	105_L	0.541	0.17
25_S	28_D	0.541	0.17
55_D	72_M	0.539	0.17
25_S	120_T	0.534	0.17
31_S	84_K	0.534	0.17
46_I	49_I	0.534	0.17
7_S	94_A	0.530	0.17
10_E	135_T	0.529	0.17
84_K	117_A	0.526	0.17
60_F	64_D	0.525	0.17
115_I	128_R	0.523	0.17
28_D	109_G	0.523	0.17
15_F	47_E	0.517	0.17
8_K	93_I	0.513	0.16
20_L	30_Q	0.508	0.16
8_K	118_H	0.505	0.16
43_H	101_Q	0.501	0.16
133_L	137_L	0.501	0.16
11_K	121_A	0.500	0.16

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ylmA	2	0.9931	100	0.502	Contact Map
1wwpA	2	0.8056	98.5	0.839	Contact Map
1wtyA	4	0.7639	96.2	0.896	Contact Map
1jogA	2	0.8681	38	0.947	Contact Map
3zjeA	2	0.4444	22.6	0.952	Contact Map
1lvaA	1	0.9792	19.7	0.954	Contact Map
2ynkA	1	0.4931	15.2	0.956	Contact Map
2mb9A	1	0.6042	14.2	0.957	Contact Map
4bt9A	2	0.3889	14	0.957	Contact Map
3ocmA	5	0.4375	13.3	0.957	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.