YUTG - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YUTG - Uncharacterized protein YutG

UniProt:	O32124	Sequences: MSENEQFSQMEAKARARMKERGVEVSDIAELVFFLQKKYHPDLTIDECTLNVNRVLAKREVQNAILTGIELDVLAEQKKLSEPLQTMLEIDESLYGVDEVLAFSIVNIYGSIGFTNYGYIDKEKPGILKRLNDKSTGECHTFLDDIVGAISAAASSRLAHRARHTE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	166 (155)
Sequences:	452 (279)
Seq/√Len:	22.4

BACSU - YUTG YPJQ

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
82_E	86_T	6.925	1.00
70_E	81_S	4.727	1.00
25_V	49_T	4.571	1.00
26_S	49_T	3.633	1.00
85_Q	89_E	3.611	1.00
78_K	89_E	3.494	1.00
20_E	73_V	3.355	1.00
120_I	148_G	2.847	0.99
67_T	95_Y	2.732	0.99
11_E	15_R	2.729	0.99
28_I	151_S	2.263	0.97
75_A	80_L	2.245	0.96
71_L	80_L	2.092	0.95
120_I	128_L	2.058	0.94
88_L	141_T	2.052	0.94
12_A	16_A	2.003	0.93
39_Y	122_K	2.000	0.93
131_L	147_V	1.979	0.93
51_N	157_R	1.973	0.93
15_R	53_N	1.961	0.92
116_N	149_A	1.877	0.91
50_L	54_R	1.860	0.90
100_V	104_S	1.645	0.84
31_L	125_P	1.585	0.81
34_F	128_L	1.529	0.79
27_D	127_I	1.517	0.78
127_I	130_R	1.501	0.77
132_N	140_H	1.483	0.77
140_H	143_L	1.481	0.76
34_F	117_Y	1.477	0.76
34_F	123_E	1.450	0.75
147_V	151_S	1.449	0.75
23_V	143_L	1.439	0.74
10_M	97_V	1.397	0.72
117_Y	120_I	1.364	0.70
30_E	45_I	1.361	0.70
69_I	143_L	1.360	0.70
88_L	139_C	1.304	0.67
146_I	156_S	1.293	0.66
78_K	85_Q	1.286	0.66
100_V	107_N	1.270	0.65
107_N	113_G	1.263	0.64
8_S	12_A	1.262	0.64
14_A	146_I	1.237	0.62
133_D	136_T	1.224	0.62
11_E	57_A	1.223	0.62
85_Q	140_H	1.203	0.60
128_L	132_N	1.198	0.60
33_F	37_K	1.184	0.59
70_E	148_G	1.182	0.59
74_L	80_L	1.175	0.58
28_I	52_V	1.166	0.58
25_V	53_N	1.152	0.57
93_S	141_T	1.134	0.56
146_I	150_I	1.128	0.55
129_K	132_N	1.127	0.55
30_E	130_R	1.120	0.55
26_S	45_I	1.109	0.54
45_I	137_G	1.100	0.53
52_V	154_A	1.085	0.52
90_I	135_S	1.085	0.52
28_I	147_V	1.079	0.52
119_Y	123_E	1.072	0.51
86_T	89_E	1.064	0.51
40_H	51_N	1.064	0.51
10_M	13_K	1.059	0.51
17_R	20_E	1.045	0.50
65_I	69_I	1.025	0.48
68_G	122_K	1.011	0.47
146_I	149_A	1.008	0.47
104_S	127_I	0.988	0.46
9_Q	158_L	0.988	0.46
70_E	73_V	0.966	0.44
80_L	85_Q	0.958	0.44
32_V	92_E	0.956	0.44
108_I	113_G	0.955	0.43
12_A	53_N	0.946	0.43
16_A	20_E	0.943	0.43
17_R	66_L	0.940	0.42
31_L	95_Y	0.935	0.42
105_I	108_I	0.933	0.42
93_S	106_V	0.920	0.41
125_P	129_K	0.905	0.40
17_R	70_E	0.897	0.40
62_Q	102_A	0.890	0.39
134_K	140_H	0.888	0.39
11_E	14_A	0.885	0.39
97_V	101_L	0.882	0.39
34_F	120_I	0.866	0.38
42_D	73_V	0.860	0.37
63_N	116_N	0.853	0.37
19_K	24_E	0.852	0.37
71_L	84_L	0.847	0.36
122_K	160_H	0.831	0.35
105_I	113_G	0.825	0.35
29_A	49_T	0.823	0.35
31_L	63_N	0.819	0.35
108_I	117_Y	0.802	0.34
81_S	85_Q	0.796	0.33
51_N	146_I	0.780	0.32
11_E	53_N	0.777	0.32
113_G	153_A	0.771	0.32
45_I	53_N	0.769	0.32
17_R	87_M	0.754	0.31
117_Y	148_G	0.752	0.31
21_R	76_E	0.751	0.31
105_I	116_N	0.749	0.30
28_I	78_K	0.749	0.30
26_S	30_E	0.748	0.30
13_K	158_L	0.746	0.30
87_M	93_S	0.744	0.30
40_H	116_N	0.743	0.30
113_G	116_N	0.742	0.30
64_A	111_S	0.740	0.30
84_L	88_L	0.737	0.30
151_S	155_S	0.736	0.30
86_T	90_I	0.735	0.30
70_E	120_I	0.735	0.30
61_V	105_I	0.730	0.29
104_S	113_G	0.720	0.29
65_I	155_S	0.718	0.29
29_A	52_V	0.718	0.29
125_P	139_C	0.712	0.28
30_E	97_V	0.710	0.28
65_I	104_S	0.710	0.28
93_S	146_I	0.707	0.28
111_S	116_N	0.707	0.28
100_V	114_F	0.706	0.28
103_F	137_G	0.706	0.28
17_R	73_V	0.702	0.28
87_M	109_Y	0.700	0.28
13_K	66_L	0.699	0.28
92_E	131_L	0.699	0.28
25_V	52_V	0.695	0.27
28_I	155_S	0.695	0.27
67_T	132_N	0.689	0.27
37_K	41_P	0.687	0.27
11_E	97_V	0.681	0.27
67_T	100_V	0.679	0.26
89_E	138_E	0.674	0.26
24_E	46_D	0.674	0.26
88_L	93_S	0.671	0.26
73_V	81_S	0.671	0.26
81_S	120_I	0.668	0.26
17_R	132_N	0.667	0.26
149_A	153_A	0.666	0.26
107_N	119_Y	0.664	0.26
64_A	94_L	0.663	0.26
62_Q	132_N	0.663	0.26
10_M	155_S	0.660	0.25
12_A	130_R	0.660	0.25
67_T	108_I	0.657	0.25
125_P	149_A	0.657	0.25
100_V	116_N	0.655	0.25
46_D	49_T	0.654	0.25
30_E	34_F	0.648	0.25
73_V	77_Q	0.646	0.25
105_I	153_A	0.644	0.25
52_V	151_S	0.643	0.25
35_L	133_D	0.641	0.25
70_E	74_L	0.633	0.24
23_V	135_S	0.633	0.24
42_D	45_I	0.632	0.24
9_Q	46_D	0.630	0.24
40_H	44_T	0.627	0.24
126_G	139_C	0.625	0.24
53_N	150_I	0.621	0.23
95_Y	100_V	0.614	0.23
49_T	123_E	0.609	0.23
62_Q	76_E	0.606	0.23
87_M	129_K	0.606	0.23
66_L	139_C	0.606	0.23
120_I	123_E	0.605	0.23
36_Q	110_G	0.601	0.23
67_T	105_I	0.597	0.22
10_M	161_R	0.597	0.22
11_E	66_L	0.593	0.22
34_F	125_P	0.593	0.22
62_Q	71_L	0.593	0.22
104_S	107_N	0.590	0.22
103_F	117_Y	0.587	0.22
108_I	116_N	0.585	0.22
77_Q	81_S	0.583	0.22
25_V	41_P	0.583	0.22
31_L	120_I	0.581	0.22
19_K	26_S	0.581	0.22
89_E	139_C	0.580	0.22
12_A	33_F	0.579	0.21
64_A	141_T	0.578	0.21
18_M	65_I	0.576	0.21
61_V	101_L	0.569	0.21
67_T	107_N	0.565	0.21
114_F	117_Y	0.563	0.21
37_K	162_A	0.556	0.20
123_E	129_K	0.555	0.20
48_C	155_S	0.555	0.20
85_Q	88_L	0.553	0.20
131_L	151_S	0.552	0.20
123_E	148_G	0.549	0.20
12_A	82_E	0.548	0.20
132_N	141_T	0.547	0.20
58_K	160_H	0.545	0.20
61_V	156_S	0.544	0.20
63_N	69_I	0.539	0.20
41_P	161_R	0.539	0.20
35_L	67_T	0.538	0.20
16_A	47_E	0.537	0.20
42_D	135_S	0.531	0.19
43_L	119_Y	0.528	0.19
66_L	88_L	0.526	0.19
149_A	156_S	0.525	0.19
111_S	141_T	0.525	0.19
70_E	117_Y	0.524	0.19
103_F	156_S	0.520	0.19
88_L	132_N	0.519	0.19
20_E	24_E	0.518	0.19
16_A	138_E	0.517	0.19
74_L	155_S	0.517	0.19
120_I	135_S	0.514	0.19
12_A	135_S	0.513	0.19
35_L	119_Y	0.512	0.19
15_R	97_V	0.510	0.18
20_E	42_D	0.510	0.18
79_K	93_S	0.510	0.18
35_L	95_Y	0.509	0.18
105_I	149_A	0.503	0.18
107_N	116_N	0.502	0.18
93_S	133_D	0.502	0.18
14_A	150_I	0.502	0.18
139_C	146_I	0.501	0.18
63_N	114_F	0.501	0.18
9_Q	12_A	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1y9iA	4	0.9578	100	0.355	Contact Map
1tlqA	4	0.9699	100	0.36	Contact Map
1rfzA	4	0.9759	100	0.361	Contact Map
1p3y1	6	0.2952	37.9	0.955	Contact Map
4oanA	1	0.3554	18.3	0.962	Contact Map
4xeqA	1	0.3434	17.1	0.962	Contact Map
4dhxB	1	0.3675	14.4	0.963	Contact Map
4n4uA	1	0.3494	12.9	0.964	Contact Map
4pfrA	1	0.3614	12.6	0.964	Contact Map
3hsqA	3	0.4759	12.4	0.964	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.