YUZD - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YUZD - Putative disulfide oxidoreductase YuzD

UniProt:	O32118	Sequences: MMKPVMLSVYGAENVCASCVNMPTAKDTYEWLEAALKRKYPNQPFEMQYIDIHEPPDNEHAKELAEKIRNDEYFYPLVLVEDKIVGEGNPKLKDVYEEMEKHGYTENR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	108 (100)
Sequences:	179 (131)
Seq/√Len:	13.1

BACSU - YUZD

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
36_L	96_Y	3.518	0.99
67_K	73_Y	3.495	0.99
98_E	101_K	3.350	0.98
73_Y	84_I	3.023	0.97
6_M	48_Q	2.628	0.93
72_E	77_L	2.585	0.92
68_I	77_L	2.195	0.84
99_M	103_G	2.166	0.83
64_L	77_L	2.035	0.79
9_V	45_F	1.937	0.76
66_E	70_N	1.917	0.75
27_D	53_H	1.862	0.73
32_L	78_V	1.651	0.63
42_N	62_K	1.625	0.62
48_Q	61_A	1.532	0.57
33_E	47_M	1.489	0.55
55_P	65_A	1.460	0.53
60_H	82_D	1.446	0.53
40_Y	100_E	1.429	0.52
29_Y	47_M	1.391	0.50
47_M	103_G	1.377	0.49
7_L	30_E	1.370	0.49
43_Q	47_M	1.346	0.47
35_A	87_E	1.334	0.47
17_A	27_D	1.332	0.47
43_Q	99_M	1.301	0.45
36_L	99_M	1.297	0.45
22_M	91_K	1.295	0.45
22_M	89_N	1.288	0.44
86_G	98_E	1.280	0.44
22_M	90_P	1.254	0.43
29_Y	33_E	1.248	0.42
69_R	77_L	1.239	0.42
24_T	45_F	1.194	0.39
27_D	60_H	1.188	0.39
15_V	22_M	1.175	0.39
48_Q	54_E	1.163	0.38
41_P	45_F	1.161	0.38
44_P	47_M	1.154	0.37
24_T	43_Q	1.142	0.37
15_V	27_D	1.128	0.36
25_A	77_L	1.116	0.36
69_R	73_Y	1.095	0.35
71_D	77_L	1.094	0.35
6_M	36_L	1.072	0.34
27_D	89_N	1.063	0.33
40_Y	85_V	1.063	0.33
33_E	99_M	1.049	0.32
61_A	85_V	1.045	0.32
54_E	66_E	1.036	0.32
68_I	102_H	1.021	0.31
63_E	66_E	1.006	0.31
64_L	68_I	0.999	0.30
26_K	63_E	0.990	0.30
34_A	78_V	0.980	0.29
15_V	24_T	0.975	0.29
17_A	73_Y	0.941	0.28
53_H	77_L	0.941	0.28
53_H	57_D	0.926	0.27
75_Y	93_K	0.905	0.26
6_M	22_M	0.894	0.26
17_A	22_M	0.892	0.26
7_L	80_V	0.889	0.26
9_V	93_K	0.888	0.26
53_H	69_R	0.885	0.25
50_I	65_A	0.878	0.25
61_A	98_E	0.873	0.25
4_P	95_V	0.872	0.25
4_P	58_N	0.869	0.25
63_E	73_Y	0.869	0.25
29_Y	74_F	0.859	0.24
69_R	72_E	0.854	0.24
12_A	52_I	0.844	0.24
42_N	55_P	0.838	0.24
15_V	21_N	0.832	0.23
50_I	66_E	0.829	0.23
78_V	81_E	0.807	0.22
35_A	92_L	0.805	0.22
4_P	46_E	0.804	0.22
15_V	86_G	0.802	0.22
39_K	83_K	0.802	0.22
7_L	67_K	0.801	0.22
8_S	84_I	0.789	0.22
47_M	79_L	0.786	0.22
72_E	94_D	0.776	0.21
15_V	42_N	0.761	0.21
52_I	68_I	0.758	0.21
8_S	17_A	0.752	0.21
65_A	82_D	0.742	0.20
10_Y	20_V	0.742	0.20
47_M	99_M	0.740	0.20
64_L	80_V	0.739	0.20
60_H	89_N	0.733	0.20
21_N	33_E	0.733	0.20
9_V	27_D	0.731	0.20
68_I	96_Y	0.731	0.20
22_M	50_I	0.730	0.20
100_E	103_G	0.730	0.20
46_E	63_E	0.727	0.20
14_N	22_M	0.726	0.20
58_N	61_A	0.715	0.19
7_L	14_N	0.712	0.19
26_K	57_D	0.703	0.19
81_E	102_H	0.696	0.19
13_E	22_M	0.690	0.18
98_E	102_H	0.676	0.18
17_A	94_D	0.676	0.18
21_N	86_G	0.659	0.18
40_Y	96_Y	0.659	0.18
20_V	29_Y	0.656	0.17
10_Y	84_I	0.652	0.17
27_D	90_P	0.639	0.17
85_V	90_P	0.639	0.17
13_E	64_L	0.634	0.17
72_E	84_I	0.633	0.17
90_P	94_D	0.628	0.17
68_I	71_D	0.628	0.17
14_N	64_L	0.623	0.16
40_Y	83_K	0.613	0.16
91_K	94_D	0.610	0.16
80_V	85_V	0.594	0.16
53_H	89_N	0.592	0.16
56_P	69_R	0.591	0.16
21_N	37_K	0.589	0.15
10_Y	55_P	0.588	0.15
50_I	97_E	0.586	0.15
97_E	101_K	0.579	0.15
85_V	101_K	0.565	0.15
43_Q	103_G	0.564	0.15
41_P	99_M	0.562	0.15
12_A	90_P	0.555	0.15
5_V	42_N	0.553	0.15
33_E	42_N	0.552	0.15
30_E	67_K	0.550	0.14
73_Y	77_L	0.544	0.14
21_N	41_P	0.544	0.14
52_I	90_P	0.542	0.14
5_V	44_P	0.541	0.14
20_V	36_L	0.538	0.14
27_D	91_K	0.536	0.14
51_D	75_Y	0.534	0.14
35_A	79_L	0.533	0.14
40_Y	54_E	0.525	0.14
34_A	92_L	0.524	0.14
34_A	87_E	0.522	0.14
10_Y	18_S	0.510	0.13
25_A	53_H	0.507	0.13
46_E	53_H	0.504	0.13
64_L	84_I	0.502	0.13
29_Y	36_L	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1xg8A	1	0.9537	100	0.086	Contact Map
1u6tA	1	0.8519	95	0.887	Contact Map
2wciA	3	0.8241	94.6	0.89	Contact Map
3ipzA	3	0.7963	94.3	0.891	Contact Map
2wulA	3	0.8241	94.2	0.892	Contact Map
3ktbA	5	0.8611	93.5	0.895	Contact Map
1egoA	1	0.787	93.5	0.895	Contact Map
2ltkA	1	0.8333	93.3	0.896	Contact Map
1ttzA	1	0.6852	93	0.897	Contact Map
1t1vA	2	0.8148	92.9	0.897	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.