YUZB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YUZB - UPF0349 protein YuzB

UniProt:	O32116	Sequences: MNPMIEFCVSNLAHGSQEARAILEKDPNLDVLEYGCLSYCGTCMESLFALVNGEVVMGETPAELVENIYTFIEENPMF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	78 (76)
Sequences:	193 (122)
Seq/√Len:	14.0

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
19_A	65_V	5.998	1.00
35_G	41_G	2.742	0.95
4_M	32_L	2.556	0.93
20_R	31_V	2.254	0.88
26_D	29_L	2.152	0.85
58_G	67_N	2.080	0.83
5_I	32_L	1.942	0.78
54_E	71_F	1.833	0.74
16_S	47_L	1.810	0.73
24_E	37_L	1.658	0.66
48_F	57_M	1.637	0.65
22_I	65_V	1.636	0.65
16_S	19_A	1.586	0.63
22_I	62_A	1.573	0.62
4_M	52_N	1.547	0.61
10_S	42_T	1.543	0.61
10_S	35_G	1.491	0.58
30_D	71_F	1.470	0.57
21_A	28_N	1.437	0.55
52_N	72_I	1.404	0.53
41_G	45_E	1.404	0.53
26_D	69_Y	1.372	0.51
5_I	20_R	1.370	0.51
38_S	52_N	1.330	0.49
48_F	52_N	1.321	0.49
3_P	74_E	1.308	0.48
30_D	74_E	1.298	0.47
2_N	30_D	1.249	0.45
18_E	22_I	1.248	0.45
52_N	56_V	1.241	0.44
67_N	70_T	1.217	0.43
33_E	51_V	1.199	0.42
71_F	75_N	1.150	0.39
58_G	63_E	1.131	0.38
2_N	26_D	1.064	0.35
27_P	33_E	1.055	0.35
3_P	30_D	1.029	0.33
3_P	6_E	0.981	0.31
72_I	76_P	0.977	0.31
28_N	31_V	0.973	0.31
59_E	63_E	0.966	0.30
5_I	29_L	0.956	0.30
69_Y	73_E	0.954	0.30
1_M	50_L	0.930	0.29
1_M	10_S	0.924	0.29
12_L	17_Q	0.918	0.28
38_S	41_G	0.904	0.28
17_Q	21_A	0.896	0.27
4_M	15_G	0.894	0.27
66_E	72_I	0.887	0.27
29_L	65_V	0.840	0.25
27_P	52_N	0.834	0.25
12_L	24_E	0.791	0.23
5_I	19_A	0.780	0.23
4_M	66_E	0.770	0.22
17_Q	39_Y	0.767	0.22
12_L	20_R	0.754	0.22
52_N	55_V	0.752	0.22
38_S	57_M	0.747	0.21
66_E	70_T	0.740	0.21
71_F	74_E	0.731	0.21
69_Y	75_N	0.725	0.21
70_T	76_P	0.719	0.20
3_P	21_A	0.712	0.20
14_H	65_V	0.709	0.20
9_V	58_G	0.701	0.20
42_T	45_E	0.701	0.20
37_L	50_L	0.691	0.19
63_E	66_E	0.689	0.19
21_A	26_D	0.689	0.19
12_L	39_Y	0.685	0.19
22_I	25_K	0.684	0.19
37_L	48_F	0.683	0.19
38_S	61_P	0.670	0.19
28_N	58_G	0.662	0.18
56_V	60_T	0.659	0.18
47_L	61_P	0.658	0.18
50_L	58_G	0.655	0.18
46_S	56_V	0.654	0.18
34_Y	60_T	0.645	0.18
6_E	34_Y	0.640	0.18
7_F	31_V	0.635	0.18
7_F	26_D	0.634	0.18
19_A	29_L	0.621	0.17
10_S	45_E	0.616	0.17
37_L	68_I	0.614	0.17
9_V	22_I	0.602	0.17
72_I	75_N	0.600	0.16
33_E	47_L	0.599	0.16
23_L	49_A	0.594	0.16
10_S	57_M	0.590	0.16
50_L	59_E	0.586	0.16
9_V	62_A	0.584	0.16
10_S	13_A	0.576	0.16
39_Y	42_T	0.574	0.16
14_H	29_L	0.560	0.15
66_E	74_E	0.550	0.15
7_F	23_L	0.547	0.15
21_A	75_N	0.546	0.15
25_K	70_T	0.538	0.15
9_V	31_V	0.531	0.15
39_Y	55_V	0.528	0.14
21_A	38_S	0.527	0.14
2_N	41_G	0.520	0.14
25_K	41_G	0.516	0.14
1_M	20_R	0.516	0.14
46_S	59_E	0.516	0.14
58_G	70_T	0.515	0.14
60_T	63_E	0.512	0.14
65_V	69_Y	0.512	0.14
28_N	39_Y	0.508	0.14
42_T	46_S	0.501	0.14
63_E	67_N	0.501	0.14
18_E	38_S	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2auvA	1	0.8718	96.9	0.813	Contact Map
1m2dA	2	0.9487	96.5	0.821	Contact Map
3i9v2	1	0.9231	93.8	0.85	Contact Map
4p6vF	1	0.8974	40.2	0.91	Contact Map
1i7hA	1	0.8846	28.1	0.917	Contact Map
1a70A	1	0.8846	25.4	0.919	Contact Map
3hrdD	1	0.9487	23.8	0.92	Contact Map
3ktbA	5	0.8077	22.7	0.921	Contact Map
1n62A	1	0.9231	20.7	0.922	Contact Map
1rm6C	1	0.9487	18.2	0.924	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0044 seconds.