SUFA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

SUFA - Uncharacterized protein SufA

UniProt:	O32113	Sequences: MSNPVTITEAAALHIKDMMKEHEEENAFLRVGVKGGGCSGLSYGMGFEHEKSESDSVFDQHGITVLVDKESLDIMNGTVIDYKQSMLGGGFTIDNPNAIASCGCGSSFRTATNAGKPEEC	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	120 (106)
Sequences:	3617 (1814)
Seq/√Len:	176.2

ECOLI - ISCA SUFA ERPA
BACSU - SUFA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
79_V	94_D	4.521	1.00
14_H	17_D	3.612	1.00
28_F	66_L	3.068	1.00
12_A	61_H	3.023	1.00
68_D	71_S	2.949	1.00
32_G	44_G	2.764	1.00
6_T	79_V	2.709	1.00
59_D	64_T	2.616	1.00
98_A	101_S	2.595	1.00
9_E	61_H	2.455	1.00
57_V	64_T	2.247	1.00
5_V	80_I	2.229	1.00
24_E	49_H	2.174	1.00
34_K	44_G	2.158	1.00
30_R	55_D	2.095	1.00
8_T	81_D	1.941	1.00
78_T	93_I	1.876	1.00
51_K	66_L	1.856	1.00
59_D	62_G	1.778	1.00
84_Q	89_G	1.694	1.00
16_K	20_K	1.612	1.00
16_K	62_G	1.581	1.00
28_F	64_T	1.580	1.00
9_E	60_Q	1.522	1.00
41_L	74_I	1.451	1.00
51_K	57_V	1.353	1.00
36_G	86_M	1.345	1.00
100_A	109_R	1.315	1.00
10_A	81_D	1.297	1.00
83_K	92_T	1.262	1.00
48_E	51_K	1.261	1.00
7_I	15_I	1.244	1.00
56_S	69_K	1.196	1.00
15_I	29_L	1.180	1.00
24_E	27_A	1.174	1.00
13_L	16_K	1.161	1.00
9_E	13_L	1.133	1.00
31_V	75_M	1.115	1.00
48_E	52_S	1.090	1.00
85_S	92_T	1.088	1.00
14_H	91_F	1.080	1.00
4_P	76_N	1.073	1.00
73_D	76_N	1.066	1.00
23_E	26_N	1.065	1.00
78_T	106_S	1.052	1.00
70_E	73_D	1.006	0.99
14_H	18_M	0.943	0.99
10_A	13_L	0.941	0.99
11_A	103_G	0.927	0.99
35_G	39_S	0.925	0.99
77_G	96_P	0.918	0.99
83_K	88_G	0.914	0.99
13_L	61_H	0.912	0.99
12_A	63_I	0.909	0.99
58_F	72_L	0.903	0.99
71_S	80_I	0.900	0.99
69_K	73_D	0.894	0.98
99_I	110_T	0.881	0.98
39_S	109_R	0.849	0.98
85_S	90_G	0.847	0.98
12_A	60_Q	0.845	0.98
7_I	65_V	0.841	0.98
14_H	82_Y	0.833	0.98
52_S	55_D	0.832	0.98
20_K	25_E	0.827	0.97
7_I	91_F	0.812	0.97
16_K	61_H	0.801	0.97
14_H	87_L	0.797	0.97
31_V	80_I	0.797	0.97
16_K	63_I	0.796	0.97
33_V	108_F	0.796	0.97
36_G	42_S	0.789	0.97
29_L	91_F	0.785	0.97
72_L	76_N	0.772	0.96
36_G	98_A	0.772	0.96
27_A	51_K	0.749	0.96
83_K	90_G	0.746	0.95
75_M	97_N	0.740	0.95
11_A	88_G	0.729	0.95
4_P	72_L	0.720	0.94
7_I	60_Q	0.717	0.94
48_E	55_D	0.715	0.94
18_M	91_F	0.710	0.94
27_A	49_H	0.709	0.94
32_G	46_G	0.701	0.94
19_M	28_F	0.700	0.94
56_S	72_L	0.699	0.94
21_E	27_A	0.697	0.93
98_A	108_F	0.693	0.93
99_I	109_R	0.690	0.93
11_A	99_I	0.689	0.93
57_V	66_L	0.688	0.93
85_S	88_G	0.688	0.93
7_I	12_A	0.686	0.93
104_C	107_S	0.684	0.93
19_M	26_N	0.678	0.92
19_M	47_F	0.676	0.92
15_I	63_I	0.671	0.92
19_M	27_A	0.670	0.92
39_S	108_F	0.667	0.92
30_R	48_E	0.660	0.91
12_A	62_G	0.657	0.91
9_E	12_A	0.655	0.91
35_G	41_L	0.654	0.91
41_L	108_F	0.651	0.91
13_L	20_K	0.649	0.91
95_N	98_A	0.644	0.90
23_E	49_H	0.640	0.90
28_F	51_K	0.637	0.90
102_C	107_S	0.631	0.90
51_K	64_T	0.629	0.89
15_I	91_F	0.627	0.89
41_L	45_M	0.618	0.89
37_G	107_S	0.614	0.88
85_S	89_G	0.610	0.88
33_V	36_G	0.610	0.88
7_I	80_I	0.606	0.88
45_M	74_I	0.606	0.88
5_V	78_T	0.605	0.88
14_H	84_Q	0.603	0.87
84_Q	103_G	0.603	0.87
56_S	73_D	0.598	0.87
15_I	19_M	0.595	0.87
39_S	100_A	0.595	0.87
82_Y	89_G	0.592	0.86
60_Q	65_V	0.589	0.86
36_G	39_S	0.589	0.86
39_S	74_I	0.584	0.86
77_G	97_N	0.579	0.85
104_C	108_F	0.577	0.85
105_G	108_F	0.575	0.85
76_N	97_N	0.569	0.84
56_S	76_N	0.565	0.84
28_F	65_V	0.563	0.84
25_E	49_H	0.563	0.84
35_G	45_M	0.563	0.84
54_S	69_K	0.561	0.83
41_L	103_G	0.557	0.83
28_F	57_V	0.555	0.83
53_E	69_K	0.555	0.83
20_K	23_E	0.555	0.83
45_M	88_G	0.553	0.82
83_K	87_L	0.548	0.82
102_C	105_G	0.539	0.81
30_R	68_D	0.535	0.80
93_I	106_S	0.535	0.80
17_D	20_K	0.531	0.80
5_V	77_G	0.530	0.80
77_G	95_N	0.528	0.79
45_M	78_T	0.527	0.79
82_Y	91_F	0.514	0.78
20_K	52_S	0.511	0.77
5_V	90_G	0.509	0.77
15_I	21_E	0.509	0.77
63_I	78_T	0.504	0.76
42_S	93_I	0.504	0.76
12_A	16_K	0.503	0.76
8_T	87_L	0.501	0.76
26_N	49_H	0.500	0.76

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2d2aA	2	0.9083	100	0.196	Contact Map
1x0gA	4	0.9167	100	0.207	Contact Map
1nwbA	1	0.8	100	0.208	Contact Map
2apnA	1	0.9167	100	0.209	Contact Map
1r94A	3	0.8083	100	0.218	Contact Map
2k4zA	1	0.8833	100	0.365	Contact Map
2p2eA	1	0.8833	99.9	0.491	Contact Map
2qgoA	1	0.8083	99.8	0.51	Contact Map
3k6qA	2	0.9667	8.7	0.94	Contact Map
4awxB	1	0.3167	8.6	0.94	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.