YUIB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YUIB - Uncharacterized membrane protein YuiB

UniProt:	O32109	Sequences: MISLPVVIISIVLFFVLFFGIGFLLNMLLRMSWIMAVIYPIVCLFIISKEKLISYVQSPGESFASLFHRVLSLAAADVLILVSGLAGAIVSGIAINMLRKRGYQMF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	106 (104)
Sequences:	125 (95)
Seq/√Len:	9.4

BACSU - YUIB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
11_I	79_L	3.890	0.98
6_V	43_C	3.061	0.92
15_F	90_V	2.876	0.89
47_I	70_V	2.826	0.89
54_S	58_S	2.474	0.81
97_M	101_R	2.398	0.78
22_G	88_A	2.234	0.73
10_S	14_F	2.129	0.69
38_I	42_V	1.932	0.61
14_F	24_L	1.768	0.54
6_V	32_S	1.741	0.53
5_P	59_P	1.719	0.52
42_V	72_S	1.709	0.52
49_K	69_R	1.627	0.48
50_E	66_L	1.624	0.48
89_I	100_K	1.624	0.48
5_P	24_L	1.584	0.46
5_P	88_A	1.582	0.46
42_V	76_A	1.569	0.46
51_K	54_S	1.509	0.43
11_I	47_I	1.508	0.43
30_R	104_Q	1.472	0.41
53_I	57_Q	1.453	0.41
42_V	93_I	1.440	0.40
37_V	86_A	1.437	0.40
34_I	83_S	1.431	0.40
16_V	31_M	1.409	0.39
16_V	48_S	1.393	0.38
79_L	83_S	1.305	0.34
10_S	20_G	1.299	0.34
65_S	69_R	1.290	0.34
14_F	46_I	1.226	0.31
19_F	94_A	1.210	0.31
30_R	94_A	1.182	0.30
45_F	73_L	1.159	0.29
7_V	11_I	1.158	0.29
4_L	8_I	1.141	0.28
52_L	56_V	1.130	0.28
12_V	74_A	1.125	0.28
30_R	80_I	1.113	0.27
93_I	97_M	1.095	0.27
12_V	86_A	1.087	0.26
30_R	82_V	1.087	0.26
58_S	70_V	1.071	0.26
32_S	95_I	1.058	0.25
59_P	72_S	1.055	0.25
17_L	95_I	1.045	0.25
45_F	57_Q	1.040	0.25
62_S	100_K	1.029	0.24
39_Y	101_R	1.010	0.24
61_E	75_A	1.009	0.24
38_I	70_V	1.000	0.23
9_I	67_F	0.998	0.23
25_L	29_L	0.994	0.23
17_L	101_R	0.977	0.23
47_I	50_E	0.975	0.23
61_E	91_S	0.969	0.22
38_I	100_K	0.963	0.22
97_M	100_K	0.962	0.22
3_S	9_I	0.958	0.22
44_L	48_S	0.937	0.21
60_G	65_S	0.930	0.21
28_L	78_V	0.927	0.21
8_I	65_S	0.926	0.21
3_S	72_S	0.921	0.21
7_V	75_A	0.910	0.21
60_G	64_A	0.904	0.20
82_V	86_A	0.903	0.20
25_L	85_L	0.891	0.20
61_E	86_A	0.875	0.20
19_F	101_R	0.875	0.20
41_I	49_K	0.874	0.20
37_V	73_L	0.869	0.19
9_I	13_L	0.864	0.19
32_S	78_V	0.860	0.19
46_I	80_I	0.846	0.19
28_L	85_L	0.835	0.19
64_A	68_H	0.829	0.18
5_P	38_I	0.829	0.18
44_L	50_E	0.828	0.18
72_S	86_A	0.824	0.18
17_L	73_L	0.822	0.18
96_N	100_K	0.822	0.18
75_A	82_V	0.816	0.18
11_I	42_V	0.815	0.18
83_S	91_S	0.812	0.18
47_I	54_S	0.811	0.18
49_K	72_S	0.806	0.18
24_L	28_L	0.797	0.18
49_K	71_L	0.776	0.17
91_S	96_N	0.771	0.17
75_A	79_L	0.770	0.17
45_F	71_L	0.768	0.17
29_L	39_Y	0.768	0.17
49_K	59_P	0.768	0.17
100_K	104_Q	0.767	0.17
43_C	70_V	0.766	0.17
36_A	80_I	0.754	0.16
31_M	74_A	0.748	0.16
30_R	36_A	0.744	0.16
4_L	97_M	0.742	0.16
90_V	100_K	0.741	0.16
30_R	86_A	0.733	0.16
59_P	65_S	0.732	0.16
44_L	67_F	0.726	0.16
3_S	6_V	0.726	0.16
22_G	28_L	0.713	0.15
11_I	82_V	0.712	0.15
17_L	34_I	0.712	0.15
89_I	93_I	0.707	0.15
44_L	68_H	0.699	0.15
37_V	65_S	0.696	0.15
25_L	76_A	0.691	0.15
24_L	78_V	0.688	0.15
45_F	67_F	0.679	0.15
32_S	43_C	0.676	0.15
14_F	50_E	0.674	0.15
38_I	94_A	0.660	0.14
9_I	15_F	0.659	0.14
22_G	38_I	0.646	0.14
41_I	89_I	0.642	0.14
6_V	9_I	0.635	0.14
4_L	101_R	0.625	0.14
4_L	86_A	0.618	0.13
48_S	55_Y	0.618	0.13
31_M	37_V	0.617	0.13
80_I	96_N	0.609	0.13
12_V	73_L	0.608	0.13
91_S	94_A	0.603	0.13
15_F	101_R	0.599	0.13
67_F	96_N	0.592	0.13
14_F	20_G	0.588	0.13
53_I	58_S	0.584	0.13
68_H	93_I	0.575	0.13
14_F	83_S	0.575	0.13
9_I	85_L	0.574	0.13
6_V	101_R	0.571	0.12
15_F	75_A	0.565	0.12
67_F	71_L	0.564	0.12
64_A	67_F	0.563	0.12
43_C	47_I	0.563	0.12
5_P	17_L	0.559	0.12
51_K	88_A	0.552	0.12
42_V	95_I	0.549	0.12
4_L	62_S	0.549	0.12
34_I	57_Q	0.548	0.12
12_V	16_V	0.542	0.12
41_I	51_K	0.535	0.12
52_L	104_Q	0.535	0.12
67_F	104_Q	0.533	0.12
11_I	56_V	0.526	0.12
70_V	96_N	0.525	0.12
43_C	91_S	0.520	0.12
45_F	51_K	0.520	0.12
56_V	95_I	0.510	0.11
57_Q	95_I	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3qvpA	1	0.4151	46.6	0.929	Contact Map
2xdoA	1	0.2925	44.6	0.929	Contact Map
4mifA	4	0.2642	39.8	0.931	Contact Map
2jaeA	2	0.3396	39	0.932	Contact Map
1coyA	1	0.3302	38.9	0.932	Contact Map
4iv9A	2	0.5283	38.8	0.932	Contact Map
3axbA	2	0.283	36.9	0.933	Contact Map
2bcgG	1	0.283	34.4	0.934	Contact Map
4dsgA	1	0.283	34.4	0.934	Contact Map
4rhfA	6	0.3208	34.1	0.934	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.