YUIC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YUIC - Uncharacterized protein YuiC

UniProt:	O32108	Sequences: MMLNMIRRLLMTCLFLLAFGTTFLSVSGIEAKDLSKWVQEHQEKHLKHAGLRLKALQQKQTQTTSAAEDKTKPLEEAFDWDEYPVQRVTATGYTAGAESTGKNPGDPLYGLTYSGVKVKRDLYSTVAADPSVFPIGTILFIPNYGLGVVADTGSAIKGNRLDLYFETVKDVYNEWGKKTLDVYVIKKGTGKITEDELEKLNETKSLQVFRNQYKTVKE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	218 (170)
Sequences:	326 (287)
Seq/√Len:	22.0

BACSU - YUIC YABE YORM YOCH

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
130_P	152_T	5.728	1.00
89_T	177_K	3.368	1.00
116_V	150_A	3.245	1.00
100_T	110_G	3.059	1.00
126_V	139_L	3.031	1.00
113_Y	152_T	2.983	0.99
167_T	170_D	2.834	0.99
128_A	149_V	2.828	0.99
113_Y	154_S	2.351	0.97
85_V	181_D	2.289	0.97
130_P	154_S	2.268	0.96
97_A	100_T	2.228	0.96
100_T	109_Y	2.093	0.94
126_V	161_L	1.946	0.92
95_A	118_V	1.927	0.91
161_L	180_L	1.913	0.91
95_A	110_G	1.811	0.88
120_R	124_S	1.801	0.88
18_A	22_T	1.797	0.88
88_V	126_V	1.789	0.88
100_T	171_V	1.786	0.88
128_A	133_F	1.768	0.87
96_G	109_Y	1.715	0.86
99_S	109_Y	1.698	0.85
90_A	144_Y	1.655	0.83
144_Y	175_W	1.638	0.83
124_S	139_L	1.597	0.81
131_S	157_K	1.594	0.81
94_T	100_T	1.573	0.80
133_F	149_V	1.573	0.80
137_T	184_V	1.569	0.80
140_F	183_Y	1.568	0.80
118_V	164_Y	1.548	0.79
34_L	184_V	1.544	0.79
99_S	114_S	1.531	0.78
75_E	79_D	1.514	0.77
125_T	164_Y	1.512	0.77
23_F	31_A	1.509	0.77
144_Y	147_G	1.502	0.77
96_G	100_T	1.495	0.76
102_K	109_Y	1.494	0.76
94_T	110_G	1.468	0.75
156_I	177_K	1.453	0.74
139_L	163_L	1.446	0.74
142_P	145_G	1.413	0.72
163_L	178_K	1.407	0.72
126_V	163_L	1.398	0.71
175_W	180_L	1.396	0.71
154_S	170_D	1.347	0.68
121_D	175_W	1.344	0.68
175_W	178_K	1.342	0.68
24_L	28_G	1.340	0.68
97_A	109_Y	1.313	0.66
29_I	37_W	1.292	0.65
89_T	175_W	1.288	0.65
91_T	127_A	1.283	0.65
144_Y	163_L	1.271	0.64
87_R	181_D	1.265	0.63
109_Y	114_S	1.251	0.63
133_F	161_L	1.239	0.62
94_T	97_A	1.237	0.62
141_I	147_G	1.229	0.61
164_Y	167_T	1.215	0.60
97_A	103_N	1.215	0.60
144_Y	150_A	1.163	0.57
80_W	140_F	1.154	0.56
181_D	184_V	1.142	0.55
147_G	180_L	1.132	0.55
127_A	172_Y	1.115	0.54
30_E	33_D	1.109	0.53
33_D	37_W	1.105	0.53
101_G	109_Y	1.099	0.53
109_Y	171_V	1.089	0.52
98_E	110_G	1.087	0.52
12_T	37_W	1.080	0.51
60_Q	66_A	1.061	0.50
83_Y	183_Y	1.054	0.49
124_S	166_E	1.045	0.49
92_G	149_V	1.039	0.48
130_P	133_F	1.038	0.48
99_S	102_K	1.023	0.47
77_A	186_K	1.010	0.46
90_A	147_G	1.010	0.46
90_A	180_L	1.005	0.46
99_S	147_G	0.998	0.46
96_G	99_S	0.998	0.46
42_Q	46_L	0.997	0.46
63_T	68_E	0.994	0.45
95_A	100_T	0.993	0.45
35_S	161_L	0.993	0.45
62_Q	65_S	0.990	0.45
138_I	147_G	0.987	0.45
23_F	27_S	0.976	0.44
160_R	180_L	0.971	0.44
17_L	34_L	0.970	0.44
17_L	38_V	0.966	0.44
41_H	160_R	0.963	0.43
17_L	31_A	0.951	0.43
135_I	154_S	0.951	0.43
30_E	67_A	0.943	0.42
75_E	78_F	0.942	0.42
17_L	29_I	0.932	0.41
43_E	66_A	0.924	0.41
21_T	131_S	0.920	0.40
165_F	171_V	0.917	0.40
120_R	139_L	0.913	0.40
120_R	175_W	0.912	0.40
69_D	81_D	0.908	0.40
174_E	182_V	0.890	0.39
83_Y	178_K	0.886	0.38
145_G	163_L	0.877	0.38
97_A	101_G	0.875	0.38
135_I	179_T	0.873	0.37
46_L	167_T	0.872	0.37
21_T	31_A	0.865	0.37
89_T	160_R	0.865	0.37
91_T	175_W	0.856	0.36
45_H	178_K	0.850	0.36
86_Q	159_N	0.846	0.36
27_S	31_A	0.839	0.35
18_A	27_S	0.837	0.35
86_Q	133_F	0.828	0.35
19_F	27_S	0.828	0.35
119_K	148_V	0.823	0.34
133_F	147_G	0.822	0.34
31_A	38_V	0.821	0.34
88_V	175_W	0.815	0.34
64_T	81_D	0.811	0.34
87_R	159_N	0.809	0.33
18_A	29_I	0.808	0.33
74_L	185_I	0.802	0.33
110_G	182_V	0.800	0.33
110_G	171_V	0.792	0.32
124_S	175_W	0.791	0.32
84_P	119_K	0.781	0.32
124_S	147_G	0.777	0.32
154_S	157_K	0.776	0.32
121_D	142_P	0.774	0.31
137_T	181_D	0.770	0.31
110_G	114_S	0.769	0.31
138_I	172_Y	0.765	0.31
35_S	40_E	0.755	0.30
24_L	30_E	0.744	0.30
12_T	170_D	0.740	0.29
96_G	114_S	0.726	0.29
46_L	55_A	0.719	0.28
141_I	184_V	0.719	0.28
57_Q	143_N	0.714	0.28
140_F	167_T	0.710	0.28
114_S	125_T	0.700	0.27
125_T	136_G	0.699	0.27
139_L	144_Y	0.699	0.27
13_C	19_F	0.698	0.27
35_S	173_N	0.692	0.27
109_Y	125_T	0.692	0.27
83_Y	186_K	0.690	0.27
60_Q	131_S	0.682	0.26
88_V	144_Y	0.680	0.26
150_A	172_Y	0.678	0.26
43_E	67_A	0.674	0.26
85_V	183_Y	0.671	0.26
68_E	73_P	0.670	0.26
141_I	185_I	0.669	0.26
89_T	103_N	0.667	0.25
50_G	64_T	0.664	0.25
92_G	133_F	0.664	0.25
124_S	144_Y	0.664	0.25
49_A	67_A	0.663	0.25
17_L	41_H	0.661	0.25
44_K	51_L	0.657	0.25
98_E	101_G	0.656	0.25
50_G	53_L	0.646	0.24
54_K	59_K	0.645	0.24
92_G	121_D	0.645	0.24
129_D	149_V	0.644	0.24
20_G	31_A	0.641	0.24
101_G	114_S	0.639	0.24
114_S	165_F	0.635	0.24
124_S	142_P	0.635	0.24
131_S	152_T	0.634	0.24
102_K	125_T	0.634	0.24
12_T	15_F	0.632	0.24
90_A	175_W	0.632	0.24
138_I	150_A	0.629	0.24
138_I	186_K	0.626	0.23
47_K	159_N	0.623	0.23
156_I	160_R	0.619	0.23
129_D	182_V	0.610	0.23
140_F	145_G	0.607	0.23
98_E	160_R	0.604	0.22
14_L	22_T	0.602	0.22
128_A	139_L	0.600	0.22
138_I	146_L	0.599	0.22
19_F	29_I	0.596	0.22
92_G	128_A	0.596	0.22
54_K	58_Q	0.595	0.22
60_Q	174_E	0.595	0.22
20_G	38_V	0.588	0.22
128_A	142_P	0.584	0.21
114_S	164_Y	0.582	0.21
50_G	57_Q	0.581	0.21
175_W	184_V	0.579	0.21
117_K	141_I	0.577	0.21
92_G	142_P	0.573	0.21
42_Q	68_E	0.569	0.21
102_K	164_Y	0.566	0.21
23_F	38_V	0.563	0.20
14_L	18_A	0.562	0.20
64_T	67_A	0.558	0.20
88_V	182_V	0.558	0.20
48_H	56_L	0.557	0.20
47_K	50_G	0.557	0.20
109_Y	124_S	0.557	0.20
55_A	60_Q	0.553	0.20
143_N	173_N	0.553	0.20
86_Q	154_S	0.552	0.20
152_T	156_I	0.552	0.20
85_V	127_A	0.550	0.20
45_H	51_L	0.550	0.20
30_E	42_Q	0.549	0.20
36_K	50_G	0.547	0.20
66_A	186_K	0.546	0.20
45_H	49_A	0.544	0.20
100_T	111_L	0.544	0.20
66_A	89_T	0.541	0.20
68_E	185_I	0.537	0.19
49_A	53_L	0.536	0.19
129_D	152_T	0.534	0.19
139_L	149_V	0.534	0.19
17_L	37_W	0.533	0.19
144_Y	180_L	0.531	0.19
115_G	129_D	0.530	0.19
171_V	175_W	0.526	0.19
91_T	129_D	0.525	0.19
145_G	178_K	0.523	0.19
63_T	66_A	0.522	0.19
97_A	114_S	0.522	0.19
85_V	180_L	0.521	0.19
15_F	26_V	0.518	0.19
50_G	66_A	0.518	0.19
17_L	35_S	0.517	0.19
19_F	38_V	0.516	0.18
100_T	114_S	0.516	0.18
20_G	23_F	0.514	0.18
139_L	167_T	0.513	0.18
88_V	142_P	0.512	0.18
61_T	75_E	0.511	0.18
152_T	155_A	0.510	0.18
123_Y	164_Y	0.507	0.18
19_F	40_E	0.507	0.18
90_A	148_V	0.503	0.18
59_K	65_S	0.502	0.18
33_D	65_S	0.501	0.18
64_T	68_E	0.501	0.18
166_E	170_D	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4wjtA	2	0.6697	100	0.342	Contact Map
2ae0X	1	0.7339	99.9	0.68	Contact Map
2g5dA	1	0.7752	99.9	0.703	Contact Map
2pnwA	1	0.7431	99.9	0.714	Contact Map
3czbA	2	0.7248	99.8	0.722	Contact Map
4avrA	2	0.4037	91.8	0.928	Contact Map
4uz3A	1	0.4541	21.3	0.96	Contact Map
2mkxA	1	0.2339	11.2	0.964	Contact Map
4pxvA	1	0.2202	10.3	0.965	Contact Map
4fuoA	2	0.3165	6.8	0.968	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.