YUIH - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YUIH - Uncharacterized oxidoreductase YuiH

UniProt:	O32103	Sequences: MYFGKTRQSDQSGRVPPNQNVTTSFPVLHTGDVPYYEDMTKWNLQVYGLVDHPMLLSFEDVKAFPRYESKNDIHCVTGWSRLDNVWQGVRACDIAEKAGVKEEAGYVILHAEEGWTTNLPLDDFLAETSLLAYAHNGEPLTPEHGFPLRGVFPHLYFWKSAKWLRGIQFTKENHPGFWERNGYHMRGDPWQNQRFTWD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	198 (176)
Sequences:	4196 (2410)
Seq/√Len:	181.6

ECOLI - YEDY
BACSU - YUIH
HALSA - Q9HQN1
SULSO - Q97U24 Q97V11

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
66_R	133_Y	3.695	1.00
57_S	60_D	3.253	1.00
90_R	93_D	3.247	1.00
51_D	99_G	3.155	1.00
68_E	87_Q	3.134	1.00
47_Y	168_Q	3.043	1.00
47_Y	166_G	3.024	1.00
51_D	101_K	2.987	1.00
109_L	167_I	2.660	1.00
64_F	97_K	2.586	1.00
110_H	166_G	2.580	1.00
87_Q	134_A	2.528	1.00
43_N	55_L	2.418	1.00
45_Q	55_L	2.306	1.00
131_L	148_L	2.177	1.00
96_E	125_L	2.134	1.00
38_D	41_K	2.100	1.00
95_A	169_F	2.086	1.00
54_M	98_A	2.050	1.00
68_E	85_V	2.043	1.00
108_I	170_T	2.038	1.00
93_D	96_E	2.038	1.00
73_I	157_F	2.025	1.00
85_V	137_G	1.963	1.00
84_N	135_H	1.927	1.00
49_L	171_K	1.919	1.00
94_I	131_L	1.859	1.00
70_K	85_V	1.853	1.00
92_C	96_E	1.826	1.00
107_V	169_F	1.823	1.00
119_L	152_F	1.810	1.00
132_A	151_V	1.778	1.00
66_R	87_Q	1.768	1.00
49_L	101_K	1.716	1.00
67_Y	90_R	1.644	1.00
50_V	53_P	1.559	1.00
52_H	99_G	1.558	1.00
110_H	168_Q	1.552	1.00
62_K	133_Y	1.543	1.00
104_A	169_F	1.524	1.00
109_L	164_L	1.523	1.00
112_E	165_R	1.505	1.00
108_I	168_Q	1.500	1.00
89_V	94_I	1.491	1.00
103_E	171_K	1.480	1.00
25_F	84_N	1.457	1.00
72_D	83_D	1.455	1.00
54_M	97_K	1.453	1.00
45_Q	166_G	1.441	1.00
91_A	124_F	1.440	1.00
58_F	62_K	1.440	1.00
131_L	164_L	1.438	1.00
66_R	134_A	1.387	1.00
40_T	59_E	1.387	1.00
63_A	97_K	1.381	1.00
109_L	150_G	1.358	1.00
134_A	139_P	1.350	1.00
56_L	97_K	1.306	1.00
129_S	152_F	1.290	1.00
107_V	124_F	1.283	1.00
60_D	63_A	1.282	1.00
49_L	103_E	1.219	1.00
19_Q	135_H	1.197	1.00
42_W	58_F	1.172	1.00
175_P	180_R	1.161	1.00
19_Q	70_K	1.134	1.00
73_I	160_S	1.133	1.00
91_A	167_I	1.125	1.00
176_G	179_E	1.121	1.00
61_V	148_L	1.104	1.00
126_A	129_S	1.098	1.00
65_P	93_D	1.073	1.00
87_Q	133_Y	1.061	1.00
69_S	130_L	1.056	1.00
49_L	104_A	1.047	1.00
111_A	161_A	1.041	1.00
64_F	89_V	1.041	1.00
44_L	148_L	1.033	1.00
46_V	50_V	1.032	1.00
22_T	141_T	1.021	0.99
152_F	160_S	1.014	0.99
123_D	155_L	1.005	0.99
67_Y	93_D	0.978	0.99
48_G	53_P	0.968	0.99
92_C	127_E	0.966	0.99
117_T	158_W	0.961	0.99
105_G	171_K	0.948	0.99
117_T	161_A	0.947	0.99
121_L	169_F	0.944	0.99
39_M	58_F	0.940	0.99
175_P	179_E	0.929	0.99
25_F	135_H	0.926	0.99
100_V	169_F	0.925	0.99
62_K	134_A	0.925	0.99
73_I	84_N	0.924	0.99
123_D	154_H	0.923	0.99
85_V	136_N	0.921	0.99
65_P	90_R	0.915	0.99
42_W	148_L	0.911	0.99
28_L	79_W	0.906	0.99
29_H	33_V	0.905	0.99
59_E	62_K	0.903	0.99
117_T	159_K	0.880	0.98
120_P	123_D	0.864	0.98
135_H	141_T	0.859	0.98
150_G	161_A	0.859	0.98
50_V	169_F	0.857	0.98
29_H	163_W	0.855	0.98
95_A	100_V	0.838	0.98
56_L	98_A	0.832	0.98
89_V	133_Y	0.831	0.98
135_H	144_H	0.829	0.98
91_A	150_G	0.825	0.98
22_T	84_N	0.823	0.98
168_Q	174_H	0.817	0.98
15_V	19_Q	0.816	0.98
40_T	58_F	0.812	0.97
123_D	186_R	0.811	0.97
84_N	136_N	0.807	0.97
64_F	93_D	0.806	0.97
46_V	54_M	0.804	0.97
67_Y	130_L	0.803	0.97
47_Y	53_P	0.797	0.97
151_V	160_S	0.792	0.97
107_V	167_I	0.786	0.97
45_Q	53_P	0.784	0.97
15_V	82_L	0.780	0.97
100_V	121_L	0.778	0.97
76_V	158_W	0.777	0.97
50_V	98_A	0.770	0.96
25_F	82_L	0.761	0.96
74_H	81_R	0.749	0.96
59_E	63_A	0.746	0.96
31_G	34_P	0.744	0.96
133_Y	148_L	0.743	0.96
27_V	143_E	0.741	0.96
131_L	150_G	0.741	0.96
56_L	60_D	0.735	0.95
25_F	163_W	0.735	0.95
108_I	179_E	0.733	0.95
50_V	104_A	0.731	0.95
141_T	144_H	0.729	0.95
133_Y	139_P	0.729	0.95
30_T	33_V	0.726	0.95
178_W	187_G	0.723	0.95
177_F	181_N	0.721	0.95
89_V	93_D	0.718	0.95
36_Y	44_L	0.716	0.95
110_H	116_T	0.715	0.95
150_G	164_L	0.706	0.94
93_D	97_K	0.702	0.94
89_V	131_L	0.701	0.94
33_V	143_E	0.699	0.94
117_T	179_E	0.693	0.94
22_T	138_E	0.692	0.94
90_R	130_L	0.688	0.94
74_H	117_T	0.687	0.93
66_R	89_V	0.681	0.93
35_Y	142_P	0.679	0.93
130_L	151_V	0.673	0.93
124_F	129_S	0.671	0.93
106_Y	174_H	0.670	0.93
132_A	150_G	0.669	0.93
95_A	98_A	0.662	0.92
22_T	135_H	0.660	0.92
78_G	190_W	0.659	0.92
91_A	95_A	0.658	0.92
108_I	174_H	0.654	0.92
50_V	54_M	0.653	0.92
27_V	34_P	0.652	0.92
39_M	146_F	0.650	0.91
95_A	125_L	0.645	0.91
16_P	19_Q	0.644	0.91
61_V	89_V	0.641	0.91
46_V	56_L	0.641	0.91
106_Y	118_N	0.638	0.91
48_G	104_A	0.636	0.91
44_L	56_L	0.629	0.90
32_D	35_Y	0.629	0.90
126_A	154_H	0.626	0.90
97_K	100_V	0.625	0.90
76_V	156_Y	0.624	0.90
158_W	179_E	0.619	0.89
54_M	60_D	0.619	0.89
73_I	151_V	0.619	0.89
77_T	80_S	0.618	0.89
36_Y	112_E	0.610	0.89
62_K	139_P	0.608	0.89
51_D	103_E	0.607	0.88
33_V	36_Y	0.604	0.88
108_I	116_T	0.602	0.88
115_W	158_W	0.597	0.88
91_A	129_S	0.596	0.88
84_N	151_V	0.595	0.87
89_V	148_L	0.591	0.87
47_Y	110_H	0.591	0.87
18_N	70_K	0.589	0.87
170_T	174_H	0.588	0.87
81_R	84_N	0.588	0.87
16_P	138_E	0.588	0.87
49_L	53_P	0.584	0.86
15_V	18_N	0.581	0.86
123_D	126_A	0.578	0.86
77_T	158_W	0.575	0.86
87_Q	90_R	0.574	0.86
132_A	148_L	0.572	0.85
156_Y	159_K	0.571	0.85
94_I	148_L	0.571	0.85
77_T	155_L	0.570	0.85
43_N	57_S	0.570	0.85
150_G	167_I	0.568	0.85
91_A	94_I	0.566	0.85
108_I	175_P	0.565	0.85
28_L	77_T	0.563	0.84
123_D	129_S	0.562	0.84
74_H	77_T	0.561	0.84
25_F	86_W	0.558	0.84
173_N	179_E	0.555	0.84
46_V	100_V	0.553	0.83
91_A	169_F	0.552	0.83
155_L	159_K	0.546	0.83
128_T	154_H	0.544	0.82
54_M	99_G	0.543	0.82
26_P	81_R	0.542	0.82
70_K	82_L	0.541	0.82
61_V	133_Y	0.540	0.82
132_A	140_L	0.540	0.82
176_G	180_R	0.539	0.82
177_F	182_G	0.538	0.82
106_Y	173_N	0.536	0.81
109_L	115_W	0.536	0.81
73_I	76_V	0.535	0.81
52_H	172_E	0.534	0.81
178_W	182_G	0.533	0.81
105_G	121_L	0.532	0.81
116_T	180_R	0.532	0.81
49_L	170_T	0.528	0.81
119_L	150_G	0.527	0.80
119_L	159_K	0.526	0.80
172_E	175_P	0.525	0.80
53_P	56_L	0.524	0.80
164_L	167_I	0.524	0.80
76_V	159_K	0.524	0.80
181_N	184_H	0.522	0.80
179_E	182_G	0.521	0.80
159_K	178_W	0.520	0.80
127_E	130_L	0.520	0.80
78_G	82_L	0.520	0.80
47_Y	50_V	0.518	0.79
108_I	118_N	0.517	0.79
99_G	169_F	0.517	0.79
71_N	151_V	0.514	0.79
36_Y	42_W	0.514	0.79
44_L	131_L	0.511	0.78
44_L	58_F	0.509	0.78
100_V	125_L	0.509	0.78
28_L	80_S	0.507	0.78
21_V	24_S	0.506	0.78
86_W	152_F	0.505	0.78
56_L	64_F	0.503	0.77
82_L	157_F	0.503	0.77
91_A	152_F	0.502	0.77
44_L	166_G	0.501	0.77
98_A	169_F	0.500	0.77

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1ogpA	4	0.9949	100	0.159	Contact Map
1soxA	2	0.9949	100	0.164	Contact Map
2a9dA	2	0.9949	100	0.164	Contact Map
2blfA	1	0.9899	100	0.198	Contact Map
2xtsA	2	0.9848	100	0.201	Contact Map
2bihA	2	0.9949	100	0.202	Contact Map
2biiA	2	0.9798	100	0.203	Contact Map
4pw3A	2	0.9798	100	0.213	Contact Map
1xdyA	3	0.9697	100	0.23	Contact Map
2nptA	1	0.4646	23.3	0.952	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0075 seconds.