YUEI - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YUEI - Uncharacterized protein YueI

UniProt:	O32092	Sequences: MSEDKMDLYLQQGMYGPLETKPDERHLFLGSLRERVVLALTKGQVLRSKPYKEAEHELKNSHNVTLLINGELQYQSYSSYIQMASRYGVPFKIVSDLQFHTPLGIVIAADIAVNRELIYIQDDIYNRSVLKS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	132 (122)
Sequences:	312 (252)
Seq/√Len:	22.8

BACSU - YUEI

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
25_R	32_L	5.719	1.00
66_L	107_I	3.931	1.00
23_D	26_H	3.155	1.00
21_K	24_E	3.112	1.00
20_T	32_L	3.082	1.00
80_Y	105_I	2.753	0.99
20_T	25_R	2.712	0.99
7_D	11_Q	2.317	0.97
81_I	91_F	2.268	0.97
55_E	86_R	2.216	0.96
42_K	72_L	2.195	0.96
25_R	31_S	1.987	0.93
44_Q	120_I	1.936	0.92
19_E	25_R	1.794	0.89
57_E	60_N	1.794	0.89
33_R	118_I	1.759	0.88
42_K	104_G	1.753	0.88
68_I	77_Y	1.751	0.88
20_T	31_S	1.727	0.87
65_T	110_D	1.638	0.84
4_D	7_D	1.614	0.83
39_A	103_L	1.563	0.81
31_S	108_A	1.536	0.80
55_E	83_M	1.475	0.77
10_L	13_G	1.436	0.75
39_A	106_V	1.408	0.73
94_V	105_I	1.405	0.73
54_A	57_E	1.388	0.72
30_G	67_L	1.314	0.68
31_S	67_L	1.287	0.66
22_P	31_S	1.277	0.66
55_E	87_Y	1.270	0.65
43_G	100_H	1.246	0.64
36_V	45_V	1.236	0.63
36_V	103_L	1.218	0.62
112_A	118_I	1.215	0.62
37_V	113_V	1.214	0.62
9_Y	104_G	1.210	0.61
113_V	120_I	1.204	0.61
22_P	38_L	1.194	0.60
19_E	45_V	1.183	0.60
28_F	38_L	1.129	0.56
52_K	56_H	1.107	0.55
39_A	118_I	1.104	0.54
58_L	66_L	1.102	0.54
13_G	47_R	1.085	0.53
52_K	55_E	1.076	0.52
41_T	44_Q	1.054	0.51
19_E	53_E	1.024	0.49
56_H	60_N	1.022	0.49
7_D	43_G	1.017	0.48
73_Q	86_R	1.010	0.48
77_Y	102_P	1.008	0.48
40_L	44_Q	0.991	0.47
60_N	97_L	0.991	0.47
59_K	87_Y	0.980	0.46
66_L	84_A	0.975	0.45
25_R	113_V	0.973	0.45
56_H	88_G	0.971	0.45
24_E	35_R	0.968	0.45
14_M	52_K	0.960	0.44
69_N	102_P	0.958	0.44
40_L	45_V	0.957	0.44
63_N	111_I	0.956	0.44
28_F	54_A	0.955	0.44
17_P	96_D	0.952	0.44
15_Y	73_Q	0.952	0.44
40_L	123_D	0.950	0.44
99_F	122_D	0.947	0.43
91_F	94_V	0.924	0.42
21_K	63_N	0.918	0.42
67_L	108_A	0.917	0.41
69_N	104_G	0.917	0.41
93_I	104_G	0.912	0.41
31_S	89_V	0.905	0.41
69_N	91_F	0.899	0.40
64_V	113_V	0.893	0.40
26_H	116_E	0.892	0.40
23_D	101_T	0.888	0.40
17_P	100_H	0.874	0.39
22_P	26_H	0.874	0.39
89_V	110_D	0.874	0.39
115_R	118_I	0.871	0.38
58_L	89_V	0.867	0.38
8_L	12_Q	0.858	0.38
38_L	120_I	0.856	0.37
42_K	46_L	0.855	0.37
100_H	111_I	0.852	0.37
58_L	107_I	0.851	0.37
82_Q	86_R	0.850	0.37
122_D	125_Y	0.845	0.37
32_L	92_K	0.840	0.36
72_L	123_D	0.817	0.35
46_L	72_L	0.814	0.35
11_Q	77_Y	0.812	0.35
97_L	101_T	0.804	0.34
39_A	119_Y	0.794	0.34
95_S	100_H	0.793	0.33
21_K	40_L	0.778	0.33
80_Y	104_G	0.774	0.32
103_L	106_V	0.774	0.32
33_R	115_R	0.765	0.32
42_K	73_Q	0.755	0.31
4_D	20_T	0.744	0.30
21_K	120_I	0.736	0.30
15_Y	33_R	0.721	0.29
107_I	112_A	0.718	0.29
49_K	87_Y	0.715	0.29
53_E	56_H	0.711	0.29
65_T	92_K	0.709	0.28
83_M	87_Y	0.709	0.28
49_K	67_L	0.707	0.28
57_E	72_L	0.707	0.28
54_A	105_I	0.703	0.28
72_L	110_D	0.701	0.28
45_V	98_Q	0.689	0.27
46_L	104_G	0.688	0.27
42_K	71_E	0.687	0.27
16_G	24_E	0.682	0.27
81_I	110_D	0.682	0.27
29_L	106_V	0.682	0.27
51_Y	102_P	0.678	0.27
51_Y	79_S	0.675	0.27
27_L	90_P	0.671	0.26
39_A	121_Q	0.668	0.26
68_I	105_I	0.665	0.26
41_T	50_P	0.662	0.26
50_P	79_S	0.659	0.26
4_D	12_Q	0.653	0.25
95_S	124_I	0.649	0.25
65_T	125_Y	0.647	0.25
63_N	107_I	0.635	0.24
23_D	85_S	0.632	0.24
64_V	107_I	0.630	0.24
26_H	117_L	0.629	0.24
79_S	86_R	0.626	0.24
45_V	74_Y	0.620	0.24
55_E	59_K	0.613	0.23
69_N	108_A	0.610	0.23
68_I	104_G	0.604	0.23
23_D	71_E	0.598	0.23
40_L	105_I	0.596	0.23
22_P	27_L	0.591	0.22
51_Y	122_D	0.587	0.22
6_M	63_N	0.578	0.22
9_Y	101_T	0.576	0.22
42_K	92_K	0.576	0.22
94_V	117_L	0.568	0.21
10_L	67_L	0.568	0.21
83_M	113_V	0.566	0.21
63_N	120_I	0.564	0.21
4_D	8_L	0.564	0.21
32_L	119_Y	0.563	0.21
63_N	71_E	0.560	0.21
37_V	64_V	0.557	0.21
43_G	101_T	0.554	0.21
54_A	66_L	0.554	0.21
27_L	72_L	0.552	0.21
40_L	114_N	0.551	0.20
42_K	56_H	0.549	0.20
53_E	103_L	0.548	0.20
28_F	83_M	0.547	0.20
33_R	112_A	0.546	0.20
64_V	90_P	0.545	0.20
47_R	75_Q	0.545	0.20
41_T	70_G	0.543	0.20
64_V	102_P	0.541	0.20
13_G	40_L	0.539	0.20
29_L	98_Q	0.538	0.20
58_L	119_Y	0.535	0.20
37_V	120_I	0.532	0.20
47_R	120_I	0.525	0.19
117_L	122_D	0.525	0.19
45_V	104_G	0.523	0.19
12_Q	51_Y	0.521	0.19
30_G	112_A	0.519	0.19
75_Q	100_H	0.517	0.19
31_S	103_L	0.515	0.19
38_L	83_M	0.512	0.19
106_V	114_N	0.509	0.19
44_Q	78_S	0.508	0.19
33_R	114_N	0.501	0.18
85_S	93_I	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ohwA	1	0.9697	100	0.07	Contact Map
2jnbA	1	0.8864	23.4	0.936	Contact Map
3j7aR	1	0.6591	21.5	0.937	Contact Map
2cr7A	1	0.5076	20	0.938	Contact Map
1ny1A	1	0.8712	18	0.939	Contact Map
3b09A	2	0.2652	16.7	0.94	Contact Map
3n2oA	2	0.3182	14.6	0.941	Contact Map
1zxjA	4	0.4697	14.5	0.941	Contact Map
3fh3A	2	0.6742	12.5	0.943	Contact Map
3nzqA	2	0.3561	12.4	0.943	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.