CDOA - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

CDOA - Cysteine dioxygenase

UniProt:	O32085	Sequences: MELYECIQDIFGGLKNPSVKDLATSLKQIPNAAKLSQPYIKEPDQYAYGRNAIYRNNELEIIVINIPPNKETTVHDHGQSIGCAMVLEGKLLNSIYRSTGEHAELSNSYFVHEGECLISTKGLIHKMSNPTSERMVSLHVYSPPLEDMTVFEEQKEVLENS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	161 (143)
Sequences:	336 (242)
Seq/√Len:	20.2

BACSU - CDOA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
91_L	137_S	4.224	1.00
61_I	140_V	3.763	1.00
84_A	127_M	3.112	0.99
119_S	122_G	2.839	0.99
42_E	65_N	2.764	0.99
140_V	144_P	2.700	0.98
81_I	118_I	2.584	0.98
92_L	110_F	2.435	0.97
46_Y	70_K	2.239	0.95
24_T	28_Q	2.210	0.95
36_S	87_L	2.182	0.94
66_I	82_G	2.163	0.94
98_S	151_F	2.136	0.94
49_G	135_M	2.041	0.92
82_G	93_N	2.017	0.91
68_P	142_S	1.978	0.91
53_I	101_E	1.892	0.88
95_I	122_G	1.777	0.85
96_Y	153_E	1.767	0.85
92_L	108_S	1.767	0.85
120_T	123_L	1.764	0.85
52_A	61_I	1.735	0.84
23_A	27_K	1.706	0.83
20_K	27_K	1.702	0.82
109_Y	117_L	1.673	0.81
67_P	70_K	1.660	0.81
88_E	133_E	1.641	0.80
94_S	105_L	1.626	0.79
80_S	143_P	1.592	0.78
26_L	84_A	1.587	0.78
29_I	36_S	1.517	0.74
75_H	89_G	1.507	0.74
66_I	72_T	1.494	0.73
33_A	53_I	1.478	0.72
22_L	136_V	1.467	0.72
30_P	35_L	1.465	0.72
142_S	147_D	1.403	0.68
58_E	151_F	1.388	0.67
59_L	70_K	1.380	0.67
61_I	144_P	1.374	0.67
84_A	117_L	1.360	0.66
83_C	142_S	1.356	0.66
65_N	70_K	1.335	0.64
31_N	36_S	1.327	0.64
145_L	148_M	1.310	0.63
39_Y	53_I	1.298	0.62
90_K	110_F	1.297	0.62
72_T	82_G	1.273	0.60
95_I	107_N	1.214	0.57
41_K	44_D	1.194	0.55
66_I	139_H	1.188	0.55
95_I	115_E	1.184	0.55
42_E	59_L	1.167	0.54
39_Y	51_N	1.137	0.52
152_E	155_K	1.121	0.51
52_A	59_L	1.101	0.49
15_K	121_K	1.099	0.49
77_H	89_G	1.098	0.49
86_V	111_V	1.078	0.48
95_I	106_S	1.078	0.48
48_Y	77_H	1.050	0.46
22_L	67_P	1.049	0.46
30_P	112_H	1.042	0.46
18_S	86_V	1.042	0.46
34_K	37_Q	1.029	0.45
45_Q	117_L	1.016	0.44
90_K	133_E	1.007	0.43
47_A	121_K	1.005	0.43
64_I	93_N	0.996	0.43
22_L	65_N	0.982	0.42
30_P	38_P	0.979	0.42
65_N	147_D	0.979	0.42
90_K	112_H	0.977	0.41
97_R	103_A	0.970	0.41
105_L	108_S	0.969	0.41
109_Y	130_P	0.957	0.40
123_L	129_N	0.950	0.40
96_Y	126_K	0.946	0.39
86_V	117_L	0.940	0.39
34_K	38_P	0.936	0.39
22_L	42_E	0.925	0.38
22_L	47_A	0.915	0.38
59_L	145_L	0.915	0.38
83_C	145_L	0.910	0.37
92_L	96_Y	0.908	0.37
97_R	106_S	0.908	0.37
15_K	100_G	0.902	0.37
58_E	94_S	0.886	0.36
20_K	23_A	0.885	0.36
104_E	110_F	0.879	0.35
22_L	83_C	0.879	0.35
82_G	148_M	0.872	0.35
66_I	138_L	0.868	0.35
47_A	98_S	0.858	0.34
64_I	91_L	0.856	0.34
104_E	112_H	0.852	0.34
20_K	30_P	0.850	0.34
93_N	119_S	0.849	0.34
49_G	129_N	0.845	0.33
31_N	60_E	0.841	0.33
84_A	137_S	0.837	0.33
72_T	79_Q	0.836	0.33
62_I	147_D	0.830	0.33
111_V	155_K	0.826	0.32
72_T	127_M	0.824	0.32
19_V	22_L	0.804	0.31
47_A	70_K	0.794	0.31
30_P	63_V	0.793	0.30
125_H	141_Y	0.792	0.30
17_P	80_S	0.789	0.30
63_V	104_E	0.788	0.30
47_A	145_L	0.787	0.30
98_S	126_K	0.783	0.30
24_T	30_P	0.779	0.30
52_A	55_R	0.778	0.30
19_V	145_L	0.775	0.29
63_V	87_L	0.767	0.29
44_D	47_A	0.761	0.29
37_Q	106_S	0.761	0.29
65_N	127_M	0.761	0.29
121_K	132_S	0.758	0.29
74_V	129_N	0.756	0.28
134_R	142_S	0.748	0.28
42_E	67_P	0.745	0.28
92_L	130_P	0.737	0.27
42_E	52_A	0.727	0.27
78_G	81_I	0.726	0.27
136_V	143_P	0.720	0.27
123_L	140_V	0.714	0.26
88_E	100_G	0.709	0.26
28_Q	132_S	0.697	0.25
13_G	102_H	0.695	0.25
30_P	114_G	0.685	0.25
97_R	104_E	0.682	0.25
26_L	40_I	0.682	0.25
56_N	99_T	0.680	0.25
84_A	103_A	0.678	0.24
55_R	59_L	0.672	0.24
137_S	140_V	0.667	0.24
31_N	114_G	0.667	0.24
88_E	134_R	0.666	0.24
51_N	118_I	0.664	0.24
39_Y	71_E	0.660	0.24
84_A	119_S	0.659	0.24
60_E	99_T	0.657	0.23
125_H	139_H	0.655	0.23
97_R	133_E	0.653	0.23
62_I	71_E	0.651	0.23
27_K	113_E	0.647	0.23
85_M	123_L	0.642	0.23
85_M	120_T	0.642	0.23
132_S	154_Q	0.638	0.23
39_Y	132_S	0.634	0.22
66_I	123_L	0.629	0.22
124_I	130_P	0.629	0.22
26_L	57_N	0.627	0.22
127_M	148_M	0.627	0.22
48_Y	141_Y	0.626	0.22
88_E	136_V	0.624	0.22
76_D	124_I	0.618	0.22
47_A	65_N	0.612	0.21
24_T	27_K	0.611	0.21
59_L	65_N	0.610	0.21
135_M	139_H	0.608	0.21
31_N	87_L	0.605	0.21
153_E	157_V	0.605	0.21
75_H	125_H	0.602	0.21
24_T	114_G	0.598	0.21
47_A	106_S	0.596	0.21
82_G	123_L	0.595	0.21
95_I	119_S	0.594	0.21
22_L	147_D	0.591	0.21
63_V	107_N	0.589	0.20
16_N	121_K	0.586	0.20
89_G	125_H	0.586	0.20
25_S	41_K	0.582	0.20
103_A	117_L	0.575	0.20
45_Q	109_Y	0.570	0.20
19_V	83_C	0.569	0.20
16_N	96_Y	0.569	0.20
23_A	37_Q	0.560	0.19
119_S	123_L	0.558	0.19
39_Y	102_H	0.551	0.19
13_G	104_E	0.551	0.19
70_K	88_E	0.550	0.19
66_I	77_H	0.549	0.19
142_S	145_L	0.548	0.19
21_D	24_T	0.548	0.19
66_I	89_G	0.546	0.19
144_P	151_F	0.544	0.19
39_Y	113_E	0.540	0.18
86_V	107_N	0.537	0.18
92_L	133_E	0.534	0.18
49_G	60_E	0.532	0.18
29_I	87_L	0.528	0.18
61_I	126_K	0.528	0.18
60_E	78_G	0.525	0.18
108_S	112_H	0.524	0.18
88_E	113_E	0.521	0.18
51_N	64_I	0.521	0.18
45_Q	59_L	0.520	0.18
39_Y	94_S	0.520	0.18
38_P	132_S	0.518	0.18
15_K	21_D	0.512	0.17
16_N	154_Q	0.509	0.17
62_I	88_E	0.509	0.17
121_K	157_V	0.505	0.17
118_I	123_L	0.505	0.17
46_Y	68_P	0.504	0.17
54_Y	61_I	0.504	0.17
88_E	121_K	0.504	0.17
50_R	77_H	0.502	0.17
48_Y	75_H	0.501	0.17
60_E	85_M	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ieuA	1	0.9876	100	0.418	Contact Map
4tlfA	1	0.9814	100	0.464	Contact Map
4qmaA	1	0.9752	100	0.488	Contact Map
4qm9A	1	0.9503	99.9	0.558	Contact Map
1v70A	2	0.6522	98.4	0.827	Contact Map
3h8uA	2	0.7578	98.2	0.839	Contact Map
2oa2A	2	0.8199	98.1	0.843	Contact Map
2q30A	2	0.6522	98.1	0.843	Contact Map
2q1zB	1	0.7516	98	0.846	Contact Map
4b29A	1	0.8758	97.9	0.848	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.