YUAE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YUAE - Uncharacterized protein YuaE

UniProt:	O32078	Sequences: MSIFNEARLETWNELKGLSDEKLNQKPSAEEWSIREVLDHLKKIDMTAQKMLKERVKDAPIKEIEEKPLEVAQDRNNKRKAPSHLEPAHDFISGSQMKRELDVVREQLTAAIASLKEEDFERVLPHPVFQELTVRQWIDFIGHHEKRHLSQMKEIKEKIERA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	162 (153)
Sequences:	353 (302)
Seq/√Len:	24.4

BACSU - YUAE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
26_K	30_E	5.491	1.00
45_D	105_R	3.170	1.00
152_M	156_K	3.108	1.00
28_S	31_E	2.876	1.00
37_V	155_I	2.844	0.99
23_L	97_M	2.769	0.99
26_K	33_S	2.717	0.99
31_E	155_I	2.700	0.99
74_D	147_R	2.616	0.99
18_L	156_K	2.608	0.99
34_I	156_K	2.546	0.99
34_I	152_M	2.544	0.99
8_R	105_R	2.490	0.99
41_L	145_E	2.235	0.97
78_K	154_E	2.069	0.95
142_G	146_K	2.015	0.95
19_S	22_K	1.977	0.94
82_P	127_P	1.941	0.94
75_R	147_R	1.914	0.93
18_L	152_M	1.754	0.90
44_I	48_A	1.734	0.89
18_L	34_I	1.716	0.89
36_E	89_H	1.632	0.86
21_E	29_A	1.612	0.85
39_D	87_P	1.578	0.84
153_K	157_E	1.550	0.83
103_V	106_E	1.524	0.82
87_P	147_R	1.519	0.81
15_L	38_L	1.512	0.81
40_H	148_H	1.449	0.78
26_K	91_F	1.430	0.77
106_E	153_K	1.429	0.77
8_R	145_E	1.429	0.77
116_K	119_D	1.357	0.73
75_R	154_E	1.353	0.73
11_T	152_M	1.332	0.72
36_E	97_M	1.318	0.71
83_S	86_E	1.312	0.71
41_L	44_I	1.307	0.70
144_H	148_H	1.301	0.70
40_H	144_H	1.301	0.70
7_A	56_V	1.300	0.70
102_D	119_D	1.297	0.70
45_D	104_V	1.291	0.69
32_W	148_H	1.279	0.69
32_W	40_H	1.279	0.69
10_E	13_N	1.274	0.68
76_N	147_R	1.270	0.68
33_S	37_V	1.265	0.68
39_D	89_H	1.263	0.68
101_L	137_W	1.244	0.67
29_A	58_D	1.240	0.66
62_K	65_E	1.237	0.66
81_A	85_L	1.211	0.64
35_R	97_M	1.200	0.64
27_P	33_S	1.180	0.62
28_S	33_S	1.156	0.61
75_R	150_S	1.136	0.59
14_E	92_I	1.132	0.59
32_W	144_H	1.124	0.59
74_D	154_E	1.119	0.58
52_L	85_L	1.117	0.58
8_R	141_I	1.116	0.58
61_I	132_L	1.112	0.58
106_E	119_D	1.088	0.56
11_T	149_L	1.078	0.55
45_D	81_A	1.070	0.55
97_M	142_G	1.067	0.55
50_K	54_E	1.062	0.54
101_L	145_E	1.054	0.54
15_L	23_L	1.054	0.54
55_R	140_F	1.054	0.54
81_A	87_P	1.053	0.54
24_N	97_M	1.046	0.53
77_N	132_L	1.042	0.53
80_K	86_E	1.027	0.52
55_R	138_I	1.026	0.52
14_E	156_K	1.016	0.51
11_T	101_L	0.995	0.49
89_H	99_R	0.994	0.49
52_L	57_K	0.993	0.49
14_E	41_L	0.993	0.49
38_L	142_G	0.982	0.48
81_A	127_P	0.980	0.48
148_H	151_Q	0.974	0.48
40_H	151_Q	0.974	0.48
37_V	118_E	0.964	0.47
127_P	137_W	0.954	0.46
49_Q	111_A	0.944	0.46
56_V	90_D	0.942	0.46
85_L	100_E	0.931	0.45
107_Q	110_A	0.930	0.45
69_L	108_L	0.924	0.44
13_N	128_V	0.910	0.43
20_D	153_K	0.900	0.43
123_V	134_V	0.893	0.42
18_L	131_E	0.887	0.42
34_I	58_D	0.884	0.41
112_I	119_D	0.873	0.41
108_L	150_S	0.873	0.41
12_W	60_P	0.842	0.39
15_L	22_K	0.836	0.38
44_I	85_L	0.833	0.38
57_K	66_E	0.821	0.37
22_K	25_Q	0.819	0.37
39_D	142_G	0.810	0.36
19_S	98_K	0.809	0.36
23_L	146_K	0.807	0.36
144_H	151_Q	0.804	0.36
76_N	154_E	0.799	0.36
23_L	50_K	0.792	0.35
13_N	58_D	0.787	0.35
126_H	132_L	0.784	0.35
32_W	151_Q	0.783	0.35
83_S	111_A	0.780	0.34
28_S	153_K	0.777	0.34
10_E	18_L	0.776	0.34
72_A	140_F	0.775	0.34
7_A	103_V	0.771	0.34
53_K	113_A	0.769	0.34
76_N	128_V	0.764	0.33
15_L	63_E	0.763	0.33
36_E	101_L	0.762	0.33
147_R	154_E	0.755	0.33
57_K	89_H	0.746	0.32
41_L	111_A	0.743	0.32
11_T	38_L	0.737	0.32
9_L	60_P	0.731	0.31
39_D	100_E	0.727	0.31
57_K	113_A	0.725	0.31
22_K	154_E	0.724	0.31
129_F	141_I	0.717	0.31
58_D	99_R	0.717	0.31
87_P	145_E	0.711	0.30
56_V	118_E	0.708	0.30
41_L	67_K	0.707	0.30
23_L	100_E	0.704	0.30
142_G	145_E	0.698	0.29
6_E	116_K	0.688	0.29
61_I	119_D	0.688	0.29
53_K	102_D	0.686	0.29
24_N	146_K	0.684	0.29
22_K	133_T	0.680	0.28
10_E	110_A	0.679	0.28
37_V	127_P	0.674	0.28
16_K	155_I	0.672	0.28
105_R	112_I	0.670	0.28
93_S	113_A	0.668	0.28
16_K	47_T	0.663	0.27
7_A	146_K	0.663	0.27
43_K	87_P	0.662	0.27
44_I	47_T	0.662	0.27
51_M	124_L	0.659	0.27
13_N	95_S	0.657	0.27
103_V	112_I	0.652	0.27
5_N	112_I	0.650	0.27
17_G	61_I	0.648	0.27
33_S	126_H	0.645	0.26
23_L	51_M	0.640	0.26
47_T	84_H	0.639	0.26
45_D	136_Q	0.635	0.26
28_S	98_K	0.634	0.26
62_K	117_E	0.633	0.26
72_A	147_R	0.632	0.26
10_E	109_T	0.631	0.26
20_D	95_S	0.629	0.25
19_S	129_F	0.628	0.25
93_S	96_Q	0.625	0.25
136_Q	152_M	0.623	0.25
8_R	101_L	0.621	0.25
15_L	60_P	0.618	0.25
8_R	104_V	0.618	0.25
58_D	118_E	0.618	0.25
23_L	130_Q	0.617	0.25
87_P	154_E	0.613	0.25
35_R	91_F	0.609	0.24
85_L	88_A	0.607	0.24
12_W	18_L	0.607	0.24
68_P	145_E	0.607	0.24
79_R	128_V	0.604	0.24
13_N	77_N	0.603	0.24
64_I	133_T	0.603	0.24
14_E	140_F	0.598	0.24
27_P	31_E	0.594	0.24
125_P	132_L	0.592	0.23
39_D	92_I	0.591	0.23
13_N	54_E	0.590	0.23
39_D	91_F	0.586	0.23
36_E	93_S	0.584	0.23
69_L	136_Q	0.582	0.23
9_L	13_N	0.581	0.23
10_E	149_L	0.575	0.23
84_H	87_P	0.574	0.23
43_K	52_L	0.574	0.23
97_M	136_Q	0.572	0.22
10_E	153_K	0.567	0.22
117_E	135_R	0.566	0.22
9_L	110_A	0.565	0.22
33_S	92_I	0.563	0.22
96_Q	109_T	0.561	0.22
49_Q	154_E	0.561	0.22
48_A	136_Q	0.561	0.22
8_R	68_P	0.560	0.22
69_L	150_S	0.551	0.21
41_L	149_L	0.548	0.21
14_E	153_K	0.547	0.21
125_P	131_E	0.546	0.21
5_N	109_T	0.543	0.21
30_E	150_S	0.542	0.21
17_G	141_I	0.542	0.21
13_N	118_E	0.540	0.21
30_E	53_K	0.540	0.21
72_A	129_F	0.537	0.21
84_H	125_P	0.537	0.21
55_R	72_A	0.534	0.21
47_T	127_P	0.532	0.21
125_P	150_S	0.530	0.20
41_L	97_M	0.524	0.20
29_A	94_G	0.523	0.20
129_F	137_W	0.522	0.20
123_V	147_R	0.515	0.20
133_T	143_H	0.512	0.20
13_N	64_I	0.509	0.19
54_E	121_E	0.508	0.19
78_K	145_E	0.506	0.19
133_T	152_M	0.505	0.19
7_A	98_K	0.504	0.19
52_L	149_L	0.503	0.19
30_E	56_V	0.502	0.19
92_I	157_E	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2yqyA	2	0.7469	99.9	0.516	Contact Map
2rd9A	4	0.9136	99.8	0.594	Contact Map
1rxqA	3	0.9259	99.7	0.604	Contact Map
3cexA	2	0.9877	99.7	0.634	Contact Map
3gorA	2	0.8395	99.6	0.636	Contact Map
2qe9A	2	0.8395	99.6	0.637	Contact Map
3dkaA	2	0.8395	99.6	0.637	Contact Map
2p1aA	2	0.858	99.6	0.645	Contact Map
3di5A	1	0.8395	99.6	0.649	Contact Map
2hkvA	2	0.8148	99.5	0.662	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0072 seconds.