YUAF - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YUAF - Uncharacterized membrane protein YuaF

UniProt:	O32077	Sequences: MELFGVPIQTMYLYTLIIAGSLTLLFLFFGDVFSGLSEGIPFLNPTLVLSFFTCFSAGGYIGELVLPLSSLLIALLSCILSIMLVVLLHIFVLVPLSSAEESLAYREDDLRGRLGKVITAVPVDGFGEVVIEGIGGTISKSAVSFDNQQISYGTTVLVVDINNGVLSVTPHEPI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	174 (164)
Sequences:	269 (212)
Seq/√Len:	16.6

BACSU - YUAF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
129_V	166_L	5.018	1.00
161_I	166_L	3.091	0.99
55_F	74_A	2.989	0.98
15_T	55_F	2.889	0.98
12_Y	77_S	2.882	0.98
143_V	167_S	2.881	0.98
115_G	129_V	2.602	0.96
19_A	56_S	2.517	0.95
71_L	82_I	2.477	0.95
47_L	89_H	2.444	0.95
117_V	121_V	2.342	0.93
32_V	83_M	2.243	0.92
15_T	56_S	2.212	0.91
12_Y	63_E	2.175	0.90
122_P	128_E	2.170	0.90
12_Y	16_L	2.133	0.89
146_D	169_T	2.070	0.88
17_I	27_L	2.068	0.88
35_G	38_E	1.995	0.86
61_I	106_R	1.987	0.86
8_I	19_A	1.948	0.84
28_F	76_L	1.863	0.82
70_S	83_M	1.781	0.78
60_Y	77_S	1.632	0.72
123_V	149_Q	1.620	0.71
28_F	61_I	1.616	0.71
52_F	75_L	1.552	0.68
41_P	67_P	1.550	0.68
115_G	158_V	1.544	0.68
75_L	82_I	1.506	0.66
51_F	143_V	1.487	0.65
52_F	68_L	1.452	0.63
54_C	84_L	1.427	0.61
42_F	115_G	1.417	0.61
55_F	153_G	1.414	0.61
27_L	146_D	1.391	0.59
63_E	70_S	1.368	0.58
32_V	76_L	1.366	0.58
21_S	81_S	1.342	0.56
117_V	141_S	1.323	0.55
71_L	74_A	1.316	0.55
81_S	85_V	1.314	0.55
50_S	85_V	1.305	0.54
62_G	119_T	1.300	0.54
68_L	76_L	1.287	0.53
42_F	60_Y	1.277	0.53
61_I	64_L	1.267	0.52
58_G	62_G	1.246	0.51
43_L	170_P	1.236	0.50
10_T	24_L	1.217	0.49
17_I	21_S	1.213	0.49
107_E	138_I	1.213	0.49
143_V	160_D	1.211	0.49
117_V	139_S	1.200	0.48
11_M	67_P	1.166	0.46
122_P	136_G	1.164	0.46
81_S	158_V	1.157	0.46
106_R	109_D	1.147	0.45
13_L	98_S	1.136	0.44
49_L	139_S	1.129	0.44
155_T	166_L	1.127	0.44
31_D	122_P	1.127	0.44
90_I	136_G	1.125	0.44
162_N	167_S	1.124	0.44
122_P	125_G	1.107	0.43
31_D	81_S	1.089	0.42
17_I	52_F	1.088	0.42
21_S	25_L	1.083	0.41
8_I	56_S	1.077	0.41
83_M	123_V	1.071	0.41
30_G	153_G	1.069	0.40
103_L	113_R	1.067	0.40
27_L	42_F	1.029	0.38
15_T	18_I	1.023	0.38
72_L	79_I	1.020	0.38
82_I	161_I	1.019	0.38
132_E	138_I	1.017	0.38
45_P	95_P	1.012	0.37
29_F	120_A	1.001	0.37
107_E	141_S	0.997	0.36
27_L	75_L	0.989	0.36
58_G	144_S	0.989	0.36
45_P	102_S	0.985	0.36
27_L	41_P	0.984	0.36
144_S	150_I	0.983	0.36
81_S	169_T	0.983	0.36
16_L	135_G	0.981	0.36
20_G	61_I	0.980	0.36
19_A	49_L	0.969	0.35
117_V	142_A	0.963	0.35
121_V	162_N	0.962	0.35
24_L	48_V	0.944	0.34
13_L	149_Q	0.943	0.34
47_L	165_V	0.935	0.33
105_Y	140_K	0.929	0.33
15_T	19_A	0.924	0.33
120_A	149_Q	0.922	0.32
112_G	127_G	0.919	0.32
24_L	27_L	0.918	0.32
43_L	146_D	0.914	0.32
82_I	148_Q	0.913	0.32
8_I	11_M	0.911	0.32
161_I	165_V	0.905	0.32
14_Y	43_L	0.902	0.31
62_G	102_S	0.882	0.30
19_A	94_V	0.882	0.30
61_I	65_V	0.870	0.30
30_G	163_N	0.869	0.30
123_V	147_N	0.867	0.30
30_G	59_G	0.867	0.30
87_L	165_V	0.860	0.29
121_V	167_S	0.859	0.29
94_V	157_L	0.859	0.29
12_Y	69_S	0.858	0.29
102_S	110_L	0.854	0.29
69_S	151_S	0.851	0.29
63_E	86_V	0.849	0.29
143_V	162_N	0.848	0.29
31_D	100_E	0.840	0.28
17_I	108_D	0.838	0.28
154_T	170_P	0.837	0.28
15_T	30_G	0.833	0.28
43_L	148_Q	0.831	0.28
84_L	87_L	0.830	0.28
115_G	156_V	0.826	0.28
34_S	38_E	0.822	0.27
45_P	84_L	0.818	0.27
89_H	165_V	0.815	0.27
49_L	167_S	0.805	0.27
62_G	73_I	0.804	0.27
58_G	77_S	0.795	0.26
21_S	85_V	0.795	0.26
10_T	144_S	0.793	0.26
17_I	97_S	0.784	0.26
23_T	49_L	0.784	0.26
121_V	142_A	0.778	0.25
45_P	53_T	0.777	0.25
48_V	151_S	0.774	0.25
39_G	65_V	0.769	0.25
21_S	158_V	0.760	0.25
101_E	141_S	0.752	0.24
62_G	86_V	0.748	0.24
40_I	160_D	0.742	0.24
13_L	60_Y	0.739	0.24
109_D	171_H	0.734	0.24
67_P	76_L	0.733	0.24
21_S	147_N	0.730	0.23
55_F	86_V	0.725	0.23
28_F	37_S	0.721	0.23
151_S	154_T	0.718	0.23
167_S	170_P	0.714	0.23
48_V	120_A	0.714	0.23
135_G	159_V	0.704	0.22
11_M	46_T	0.695	0.22
14_Y	60_Y	0.690	0.22
51_F	135_G	0.689	0.22
16_L	118_I	0.688	0.22
22_L	52_F	0.686	0.22
53_T	84_L	0.686	0.22
115_G	160_D	0.678	0.21
72_L	75_L	0.677	0.21
78_C	105_Y	0.674	0.21
28_F	41_P	0.672	0.21
116_K	153_G	0.671	0.21
62_G	164_G	0.669	0.21
12_Y	121_V	0.667	0.21
26_F	134_I	0.665	0.21
35_G	115_G	0.663	0.21
153_G	158_V	0.661	0.21
58_G	80_L	0.659	0.21
92_V	141_S	0.659	0.21
103_L	107_E	0.657	0.20
125_G	128_E	0.653	0.20
24_L	154_T	0.653	0.20
35_G	158_V	0.652	0.20
50_S	134_I	0.648	0.20
111_R	147_N	0.647	0.20
115_G	139_S	0.643	0.20
48_V	62_G	0.643	0.20
12_Y	24_L	0.643	0.20
54_C	126_F	0.640	0.20
159_V	171_H	0.639	0.20
35_G	122_P	0.639	0.20
100_E	104_A	0.634	0.20
80_L	151_S	0.632	0.19
32_V	36_L	0.628	0.19
28_F	85_V	0.628	0.19
51_F	96_L	0.628	0.19
12_Y	20_G	0.628	0.19
16_L	159_V	0.627	0.19
16_L	97_S	0.626	0.19
62_G	77_S	0.626	0.19
32_V	65_V	0.626	0.19
62_G	108_D	0.625	0.19
57_A	93_L	0.623	0.19
9_Q	90_I	0.623	0.19
96_L	101_E	0.623	0.19
11_M	69_S	0.611	0.19
71_L	84_L	0.609	0.19
25_L	150_I	0.608	0.19
81_S	119_T	0.606	0.19
66_L	80_L	0.604	0.18
32_V	71_L	0.604	0.18
21_S	154_T	0.604	0.18
92_V	169_T	0.603	0.18
117_V	131_I	0.602	0.18
37_S	50_S	0.601	0.18
32_V	35_G	0.597	0.18
114_L	159_V	0.595	0.18
27_L	78_C	0.594	0.18
53_T	110_L	0.593	0.18
29_F	165_V	0.593	0.18
52_F	87_L	0.592	0.18
73_I	83_M	0.592	0.18
73_I	96_L	0.588	0.18
68_L	74_A	0.587	0.18
67_P	71_L	0.586	0.18
143_V	147_N	0.583	0.18
70_S	155_T	0.582	0.18
61_I	144_S	0.580	0.18
122_P	131_I	0.580	0.18
41_P	164_G	0.570	0.17
27_L	77_S	0.568	0.17
29_F	36_L	0.566	0.17
76_L	165_V	0.566	0.17
107_E	115_G	0.565	0.17
28_F	38_E	0.560	0.17
91_F	94_V	0.557	0.17
86_V	135_G	0.556	0.17
51_F	124_D	0.554	0.17
23_T	95_P	0.552	0.17
108_D	162_N	0.543	0.16
66_L	73_I	0.542	0.16
12_Y	39_G	0.539	0.16
11_M	39_G	0.536	0.16
96_L	126_F	0.534	0.16
16_L	145_F	0.530	0.16
23_T	53_T	0.527	0.16
39_G	51_F	0.525	0.16
129_V	138_I	0.523	0.16
23_T	77_S	0.515	0.16
33_F	37_S	0.512	0.15
20_G	70_S	0.511	0.15
89_H	94_V	0.510	0.15
79_I	167_S	0.501	0.15
75_L	104_A	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2k14A	1	0.4828	99.5	0.733	Contact Map
2k5hA	1	0.5632	98.5	0.82	Contact Map
3cp0A	1	0.3563	98.4	0.825	Contact Map
3wwvA	2	0.3678	97.7	0.854	Contact Map
2exdA	1	0.4138	97.6	0.856	Contact Map
3ne5A	3	0.6034	63.5	0.93	Contact Map
4mt1A	3	0.592	60	0.931	Contact Map
3w9iA	3	0.6092	53.1	0.934	Contact Map
4k0jA	3	0.5805	48.2	0.936	Contact Map
3aqpA	1	0.5402	45.4	0.937	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.