YTZB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YTZB - Uncharacterized protein YtzB

UniProt:	O32065	Sequences: MKLRHLLLGAGLGICTAVVVRQYVMKPYISSEKALRIVKSAFKQRGPIDGSWIYTQPEPYNINGETVQVYKTGITRSAFGELEQYEVMVDAKTGEIVDVIDTIAS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	105 (97)
Sequences:	203 (164)
Seq/√Len:	16.6

BACSU - YTZB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
34_A	89_V	4.782	1.00
21_R	25_M	2.827	0.98
58_E	71_K	2.806	0.98
42_F	76_R	2.648	0.97
72_T	87_V	2.586	0.96
6_L	9_G	2.415	0.94
93_T	99_V	2.132	0.89
54_Y	58_E	2.060	0.88
32_E	61_N	1.980	0.85
13_G	39_K	1.960	0.85
31_S	55_T	1.950	0.85
42_F	46_G	1.805	0.80
46_G	76_R	1.768	0.78
17_A	62_I	1.753	0.77
42_F	47_P	1.709	0.76
23_Y	59_P	1.621	0.72
55_T	58_E	1.596	0.70
34_A	67_V	1.582	0.70
75_T	82_L	1.563	0.69
82_L	85_Y	1.480	0.64
60_Y	71_K	1.387	0.59
6_L	64_G	1.360	0.58
42_F	99_V	1.337	0.56
7_L	37_I	1.337	0.56
46_G	86_E	1.324	0.56
58_E	75_T	1.289	0.53
38_V	99_V	1.280	0.53
36_R	75_T	1.252	0.51
37_I	97_V	1.250	0.51
8_L	48_I	1.243	0.51
60_Y	88_M	1.213	0.49
34_A	65_E	1.188	0.47
61_N	64_G	1.187	0.47
43_K	46_G	1.160	0.46
71_K	88_M	1.160	0.46
84_Q	98_D	1.104	0.43
78_A	85_Y	1.093	0.42
75_T	97_V	1.091	0.42
21_R	97_V	1.084	0.41
15_C	29_I	1.070	0.41
65_E	95_E	1.068	0.41
47_P	84_Q	1.066	0.40
31_S	84_Q	1.058	0.40
37_I	89_V	1.047	0.39
15_C	19_V	1.047	0.39
4_R	15_C	1.039	0.39
42_F	86_E	1.036	0.39
8_L	57_P	1.017	0.38
29_I	84_Q	1.013	0.37
12_L	22_Q	1.011	0.37
42_F	74_I	1.007	0.37
9_G	13_G	0.997	0.37
38_V	84_Q	0.970	0.35
54_Y	75_T	0.963	0.35
49_D	82_L	0.960	0.35
36_R	55_T	0.958	0.34
10_A	18_V	0.953	0.34
13_G	96_I	0.952	0.34
54_Y	71_K	0.944	0.34
25_M	85_Y	0.940	0.33
58_E	69_V	0.932	0.33
34_A	49_D	0.911	0.32
22_Q	43_K	0.910	0.32
30_S	95_E	0.910	0.32
31_S	67_V	0.908	0.32
18_V	62_I	0.899	0.31
34_A	58_E	0.895	0.31
10_A	100_I	0.886	0.31
36_R	40_S	0.869	0.30
39_K	62_I	0.863	0.30
76_R	85_Y	0.861	0.29
29_I	77_S	0.860	0.29
40_S	56_Q	0.859	0.29
23_Y	34_A	0.834	0.28
9_G	16_T	0.829	0.28
12_L	80_G	0.825	0.28
46_G	74_I	0.819	0.27
25_M	77_S	0.818	0.27
75_T	80_G	0.806	0.27
38_V	76_R	0.800	0.27
59_P	64_G	0.790	0.26
61_N	66_T	0.788	0.26
88_M	97_V	0.782	0.26
11_G	14_I	0.780	0.26
54_Y	97_V	0.777	0.25
47_P	82_L	0.765	0.25
20_V	29_I	0.753	0.24
42_F	93_T	0.736	0.24
47_P	76_R	0.728	0.23
10_A	37_I	0.724	0.23
26_K	74_I	0.718	0.23
57_P	60_Y	0.716	0.23
6_L	25_M	0.711	0.23
76_R	82_L	0.711	0.23
35_L	39_K	0.707	0.22
29_I	33_K	0.707	0.22
45_R	63_N	0.704	0.22
11_G	44_Q	0.701	0.22
5_H	89_V	0.698	0.22
14_I	20_V	0.695	0.22
17_A	74_I	0.692	0.22
7_L	96_I	0.684	0.22
18_V	100_I	0.674	0.21
12_L	16_T	0.671	0.21
32_E	39_K	0.667	0.21
9_G	39_K	0.652	0.20
10_A	98_D	0.638	0.20
17_A	95_E	0.637	0.20
34_A	77_S	0.635	0.20
68_Q	92_K	0.633	0.20
55_T	71_K	0.609	0.19
38_V	71_K	0.607	0.19
41_A	44_Q	0.605	0.19
18_V	51_S	0.596	0.18
78_A	83_E	0.595	0.18
28_Y	75_T	0.592	0.18
14_I	80_G	0.592	0.18
16_T	85_Y	0.589	0.18
22_Q	75_T	0.586	0.18
37_I	91_A	0.582	0.18
92_K	97_V	0.576	0.18
10_A	85_Y	0.576	0.18
60_Y	74_I	0.573	0.17
70_Y	73_G	0.573	0.17
42_F	78_A	0.571	0.17
28_Y	44_Q	0.565	0.17
30_S	71_K	0.561	0.17
9_G	74_I	0.561	0.17
36_R	62_I	0.557	0.17
6_L	69_V	0.550	0.17
4_R	47_P	0.545	0.16
7_L	24_V	0.544	0.16
33_K	57_P	0.543	0.16
64_G	81_E	0.534	0.16
84_Q	100_I	0.532	0.16
19_V	36_R	0.532	0.16
74_I	86_E	0.526	0.16
60_Y	69_V	0.520	0.16
16_T	41_A	0.520	0.16
72_T	90_D	0.516	0.16
9_G	59_P	0.512	0.15
87_V	90_D	0.510	0.15
28_Y	92_K	0.508	0.15
45_R	61_N	0.503	0.15
15_C	24_V	0.501	0.15
32_E	58_E	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3nqzA	1	0.9714	94.4	0.863	Contact Map
4k90B	1	0.9619	79.1	0.897	Contact Map
3j61T	1	0.8286	25.5	0.928	Contact Map
3dw0A	1	0.3429	22.5	0.93	Contact Map
4exrA	2	0.8381	20.1	0.931	Contact Map
3ldtA	2	0.7048	17.4	0.933	Contact Map
4w20T	1	0.8286	16.3	0.934	Contact Map
1rypD	1	0.7905	15.5	0.935	Contact Map
4oh0A	1	0.619	15.1	0.935	Contact Map
4zdxA	1	0.5429	15.1	0.935	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.