YRZF - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YRZF - Putative serine/threonine-protein kinase YrzF

UniProt:	O32057	Sequences: MLTKAEALAHTVIYRKNSRFDKVKEKSEELTLIGKGRSAYVFALTEGGRKMALKVFFPEYQATAVKEAAIYEKLAGSAFYPDIYETGDSFILMEYIKGETFYNCLKKGIAISDDMIQQVEEALSDARAAGLNPSDIHLRNLILTETGAVRVIDVARFEQTKTCTQWDDLKSAYHALYKKPIFPKKIPGFWLEIIAFLYKKDWFQKHFAQRKRKYS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	215 (178)
Sequences:	80648 (47624)
Seq/√Len:	3569.6

ECOLI - YEGI
BACSU - YRZF PRKC PKN1 YBDM
HALSA - Q9HR00
SULSO - Q97U18 Q97U41 Q97WD5 Q97ZY9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
43_A	50_K	3.271	1.00
142_I	152_I	3.095	1.00
31_T	43_A	2.775	1.00
32_L	40_Y	2.636	1.00
44_L	51_M	2.355	1.00
124_S	128_A	2.325	1.00
44_L	53_L	2.319	1.00
137_H	172_A	2.279	1.00
120_E	191_L	2.270	1.00
97_K	145_E	2.196	1.00
32_L	35_K	2.184	1.00
102_Y	139_R	2.157	1.00
118_Q	149_V	2.156	1.00
144_T	148_A	2.129	1.00
76_G	82_D	2.120	1.00
118_Q	148_A	2.053	1.00
28_E	47_G	2.051	1.00
77_S	125_D	2.029	1.00
171_S	176_L	2.004	1.00
141_L	149_V	2.003	1.00
94_E	150_R	1.969	1.00
123_L	191_L	1.926	1.00
119_V	141_L	1.918	1.00
28_E	45_T	1.903	1.00
43_A	95_Y	1.895	1.00
30_L	45_T	1.880	1.00
144_T	150_R	1.868	1.00
45_T	50_K	1.855	1.00
177_Y	186_I	1.777	1.00
84_Y	94_E	1.702	1.00
82_D	94_E	1.673	1.00
96_I	144_T	1.655	1.00
26_K	46_E	1.645	1.00
100_T	103_N	1.635	1.00
136_I	194_I	1.581	1.00
112_S	115_M	1.572	1.00
32_L	42_F	1.569	1.00
123_L	136_I	1.563	1.00
79_F	122_A	1.548	1.00
35_K	40_Y	1.472	1.00
53_L	92_L	1.462	1.00
113_D	116_I	1.462	1.00
49_R	84_Y	1.443	1.00
175_A	197_L	1.426	1.00
30_L	43_A	1.412	1.00
102_Y	106_K	1.412	1.00
99_E	107_K	1.406	1.00
122_A	151_V	1.390	1.00
138_L	175_A	1.390	1.00
131_L	157_F	1.334	1.00
79_F	121_E	1.327	1.00
55_V	90_F	1.305	1.00
141_L	194_I	1.295	1.00
51_M	92_L	1.293	1.00
73_K	159_Q	1.282	1.00
96_I	150_R	1.280	1.00
41_V	52_A	1.278	1.00
116_I	199_K	1.253	1.00
125_D	129_A	1.251	1.00
138_L	194_I	1.240	1.00
105_L	197_L	1.238	1.00
104_C	108_G	1.229	1.00
50_K	95_Y	1.221	1.00
102_Y	197_L	1.197	1.00
180_P	186_I	1.174	1.00
30_L	50_K	1.152	1.00
70_I	157_F	1.149	1.00
123_L	127_R	1.144	1.00
42_F	55_V	1.141	1.00
134_S	170_K	1.133	1.00
29_E	42_F	1.131	1.00
96_I	142_I	1.128	1.00
119_V	149_V	1.122	1.00
133_P	136_I	1.117	1.00
177_Y	180_P	1.112	1.00
53_L	90_F	1.110	1.00
87_G	90_F	1.108	1.00
73_K	129_A	1.107	1.00
138_L	197_L	1.106	1.00
51_M	84_Y	1.103	1.00
46_E	49_R	1.076	1.00
87_G	92_L	1.072	1.00
96_I	152_I	1.071	1.00
81_P	152_I	1.065	1.00
33_I	95_Y	1.064	1.00
83_I	86_T	1.054	1.00
193_I	196_F	1.048	1.00
81_P	93_M	1.046	1.00
108_G	115_M	1.045	1.00
71_Y	83_I	1.044	1.00
121_E	124_S	1.036	1.00
113_D	117_Q	1.030	1.00
143_L	149_V	1.024	1.00
191_L	195_A	1.023	1.00
104_C	143_L	1.022	1.00
81_P	96_I	1.018	1.00
58_P	88_D	1.014	1.00
99_E	152_I	1.012	1.00
131_L	159_Q	1.009	1.00
61_Q	65_V	1.003	1.00
156_R	170_K	1.002	1.00
50_K	97_K	0.999	1.00
135_D	140_N	0.989	1.00
189_F	193_I	0.983	1.00
80_Y	126_A	0.983	1.00
52_A	95_Y	0.981	1.00
79_F	148_A	0.978	1.00
119_V	136_I	0.973	1.00
126_A	154_V	0.958	1.00
79_F	118_Q	0.947	1.00
119_V	194_I	0.941	1.00
65_V	69_A	0.930	1.00
144_T	147_G	0.927	1.00
40_Y	57_F	0.923	1.00
140_N	153_D	0.923	1.00
104_C	111_I	0.922	1.00
29_E	44_L	0.915	1.00
27_S	85_E	0.907	1.00
196_F	200_K	0.892	1.00
68_A	86_T	0.888	1.00
76_G	125_D	0.884	1.00
71_Y	93_M	0.876	1.00
114_D	117_Q	0.864	1.00
136_I	151_V	0.861	1.00
116_I	198_Y	0.861	1.00
74_L	125_D	0.859	1.00
74_L	126_A	0.858	1.00
119_V	191_L	0.854	1.00
100_T	139_R	0.854	1.00
111_I	116_I	0.853	1.00
74_L	131_L	0.851	1.00
83_I	91_I	0.847	1.00
102_Y	138_L	0.842	1.00
26_K	48_G	0.836	1.00
193_I	197_L	0.817	1.00
98_G	147_G	0.817	1.00
125_D	128_A	0.815	1.00
27_S	92_L	0.814	1.00
126_A	131_L	0.814	1.00
34_G	41_V	0.813	1.00
179_K	186_I	0.804	1.00
40_Y	55_V	0.802	1.00
26_K	85_E	0.799	1.00
105_L	198_Y	0.794	1.00
77_S	121_E	0.793	1.00
112_S	116_I	0.787	1.00
120_E	188_G	0.786	1.00
78_A	148_A	0.781	1.00
70_I	131_L	0.778	1.00
83_I	93_M	0.763	1.00
29_E	55_V	0.762	1.00
99_E	103_N	0.759	1.00
66_K	69_A	0.759	1.00
78_A	121_E	0.750	1.00
99_E	104_C	0.748	1.00
119_V	122_A	0.739	1.00
34_G	52_A	0.736	1.00
69_A	72_E	0.733	1.00
68_A	72_E	0.733	1.00
65_V	88_D	0.727	1.00
104_C	115_M	0.726	1.00
44_L	92_L	0.724	1.00
46_E	51_M	0.715	1.00
101_F	198_Y	0.714	1.00
35_K	57_F	0.710	1.00
188_G	192_E	0.700	1.00
96_I	143_L	0.700	1.00
177_Y	181_I	0.696	1.00
27_S	46_E	0.695	1.00
137_H	140_N	0.694	1.00
27_S	51_M	0.689	1.00
82_D	150_R	0.684	1.00
77_S	80_Y	0.683	1.00
174_H	189_F	0.679	1.00
36_G	39_A	0.678	1.00
30_L	44_L	0.677	1.00
169_L	176_L	0.677	1.00
80_Y	125_D	0.676	1.00
137_H	153_D	0.670	1.00
176_L	180_P	0.669	1.00
195_A	198_Y	0.667	1.00
101_F	194_I	0.663	1.00
36_G	52_A	0.663	1.00
60_Y	63_T	0.659	1.00
70_I	159_Q	0.658	1.00
46_E	85_E	0.658	1.00
134_S	158_E	0.657	1.00
68_A	83_I	0.653	1.00
62_A	65_V	0.649	1.00
61_Q	88_D	0.649	1.00
118_Q	121_E	0.643	1.00
26_K	47_G	0.643	1.00
68_A	91_I	0.640	1.00
29_E	53_L	0.634	1.00
49_R	82_D	0.633	1.00
135_D	172_A	0.632	1.00
29_E	32_L	0.627	1.00
77_S	122_A	0.625	1.00
111_I	115_M	0.623	1.00
58_P	89_S	0.622	1.00
98_G	144_T	0.611	1.00
96_I	99_E	0.611	1.00
176_L	181_I	0.609	1.00
56_F	64_A	0.608	1.00
95_Y	99_E	0.607	1.00
185_K	188_G	0.606	1.00
24_K	27_S	0.600	1.00
99_E	142_I	0.599	1.00
69_A	73_K	0.598	1.00
104_C	147_G	0.596	1.00
186_I	190_W	0.595	1.00
80_Y	154_V	0.594	1.00
139_R	172_A	0.593	1.00
172_A	175_A	0.593	1.00
105_L	138_L	0.590	1.00
118_Q	122_A	0.589	1.00
115_M	147_G	0.589	1.00
164_T	167_D	0.588	1.00
174_H	193_I	0.580	1.00
132_N	186_I	0.577	1.00
195_A	199_K	0.577	1.00
46_E	84_Y	0.575	1.00
158_E	166_W	0.572	1.00
97_K	144_T	0.572	1.00
127_R	187_P	0.571	1.00
126_A	151_V	0.569	1.00
116_I	195_A	0.568	1.00
191_L	194_I	0.568	1.00
30_L	42_F	0.567	1.00
110_A	113_D	0.564	1.00
69_A	159_Q	0.561	1.00
67_E	71_Y	0.559	1.00
24_K	29_E	0.557	1.00
85_E	92_L	0.556	1.00
39_A	56_F	0.554	1.00
132_N	187_P	0.554	1.00
123_L	188_G	0.553	1.00
98_G	145_E	0.552	1.00
94_E	144_T	0.552	1.00
62_A	66_K	0.551	1.00
81_P	150_R	0.549	1.00
132_N	160_T	0.547	1.00
39_A	54_K	0.545	1.00
103_N	106_K	0.544	1.00
163_C	166_W	0.543	1.00
81_P	122_A	0.543	1.00
166_W	169_L	0.540	1.00
103_N	107_K	0.538	1.00
176_L	186_I	0.535	1.00
133_P	151_V	0.534	1.00
197_L	200_K	0.531	1.00
27_S	87_G	0.531	1.00
33_I	43_A	0.530	1.00
123_L	151_V	0.529	1.00
59_E	62_A	0.528	1.00
80_Y	122_A	0.525	1.00
101_F	141_L	0.522	1.00
67_E	135_D	0.521	1.00
63_T	66_K	0.518	1.00
81_P	94_E	0.518	1.00
119_V	151_V	0.514	1.00
70_I	154_V	0.511	1.00
25_E	47_G	0.511	1.00
120_E	124_S	0.511	1.00
45_T	48_G	0.509	1.00
33_I	41_V	0.503	1.00
38_S	156_R	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4lqsA	1	0.9302	100	0.204	Contact Map
4aw2A	2	0.9953	100	0.204	Contact Map
4fr4A	1	0.9163	100	0.209	Contact Map
4im0A	2	0.8279	100	0.214	Contact Map
4dc2A	1	0.8977	100	0.218	Contact Map
4gv1A	1	0.907	100	0.222	Contact Map
4euuA	2	0.9163	100	0.223	Contact Map
3zonA	1	0.9116	100	0.223	Contact Map
4kikA	2	0.9256	100	0.223	Contact Map
3v8sA	2	0.9907	100	0.228	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0071 seconds.