YRZE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YRZE - Uncharacterized membrane protein YrzE

UniProt:	O32051	Sequences: MSDGFEQKEQKPFNTGREETIMEETKQVGKGILYGLIAIFSAMLLTSLAVSLLLTATSLEESSFNWLITAISFLSLFIGGFISGGKGKERGWMIGALTALSFSLIILLFQYLGFGKTFTAEQLIFHLGFLGVCMLGGIFGVNMRGNRSST	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	150 (120)
Sequences:	226 (188)
Seq/√Len:	17.2

BACSU - YRZE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
118_F	126_H	3.030	0.99
47_S	141_V	2.758	0.98
53_L	57_T	2.331	0.94
42_A	75_S	2.304	0.93
107_L	138_I	2.169	0.91
66_W	99_A	2.119	0.90
87_G	94_I	2.109	0.90
30_K	41_S	2.092	0.89
66_W	102_F	2.000	0.87
124_I	128_G	1.959	0.86
49_A	132_V	1.948	0.86
96_A	130_L	1.907	0.84
33_L	119_T	1.816	0.81
36_L	52_L	1.816	0.81
99_A	102_F	1.754	0.79
75_S	143_M	1.713	0.77
127_L	138_I	1.708	0.77
87_G	133_C	1.689	0.76
43_M	55_T	1.688	0.76
102_F	115_G	1.650	0.74
74_L	97_L	1.642	0.74
103_S	126_H	1.624	0.73
30_K	48_L	1.624	0.73
31_G	43_M	1.618	0.73
128_G	135_L	1.596	0.72
107_L	118_F	1.586	0.71
46_T	93_M	1.563	0.70
80_G	84_G	1.547	0.69
97_L	101_S	1.544	0.69
84_G	98_T	1.513	0.67
76_L	133_C	1.498	0.67
54_L	61_E	1.496	0.67
135_L	139_F	1.470	0.65
99_A	130_L	1.450	0.64
76_L	87_G	1.450	0.64
50_V	114_F	1.422	0.63
61_E	98_T	1.353	0.59
39_I	125_F	1.312	0.56
43_M	50_V	1.289	0.55
70_A	144_R	1.261	0.53
72_S	102_F	1.257	0.53
69_T	132_V	1.257	0.53
110_Q	122_Q	1.245	0.52
74_L	121_E	1.226	0.51
107_L	126_H	1.222	0.51
86_K	115_G	1.220	0.51
27_Q	42_A	1.213	0.50
49_A	108_L	1.195	0.49
73_F	118_F	1.177	0.48
36_L	89_E	1.171	0.48
28_V	83_S	1.167	0.47
28_V	90_R	1.152	0.47
43_M	72_S	1.126	0.45
71_I	132_V	1.105	0.44
99_A	127_L	1.099	0.43
54_L	57_T	1.090	0.43
103_S	118_F	1.084	0.43
47_S	80_G	1.069	0.42
44_L	68_I	1.043	0.40
40_F	141_V	1.025	0.39
79_G	141_V	1.013	0.38
34_Y	38_A	1.002	0.38
71_I	83_S	0.990	0.37
48_L	134_M	0.980	0.37
57_T	63_S	0.974	0.36
124_I	135_L	0.973	0.36
68_I	74_L	0.973	0.36
66_W	70_A	0.960	0.35
84_G	112_L	0.954	0.35
136_G	141_V	0.951	0.35
48_L	104_L	0.943	0.35
64_F	71_I	0.933	0.34
34_Y	55_T	0.930	0.34
70_A	99_A	0.914	0.33
105_I	139_F	0.913	0.33
53_L	145_G	0.911	0.33
76_L	94_I	0.907	0.33
104_L	145_G	0.901	0.32
78_I	114_F	0.897	0.32
70_A	74_L	0.895	0.32
80_G	111_Y	0.893	0.32
36_L	138_I	0.887	0.32
33_L	103_S	0.882	0.31
80_G	112_L	0.878	0.31
41_S	52_L	0.867	0.31
74_L	131_G	0.866	0.30
84_G	111_Y	0.865	0.30
33_L	96_A	0.858	0.30
29_G	109_F	0.853	0.30
37_I	143_M	0.849	0.30
51_S	86_K	0.847	0.30
39_I	118_F	0.845	0.29
42_A	90_R	0.845	0.29
41_S	71_I	0.836	0.29
37_I	59_L	0.834	0.29
40_F	51_S	0.827	0.29
84_G	113_G	0.799	0.27
74_L	124_I	0.798	0.27
36_L	92_W	0.795	0.27
54_L	80_G	0.795	0.27
48_L	51_S	0.792	0.27
118_F	122_Q	0.789	0.27
82_I	100_L	0.778	0.26
33_L	88_K	0.775	0.26
38_A	82_I	0.772	0.26
50_V	63_S	0.768	0.26
122_Q	125_F	0.764	0.26
123_L	127_L	0.761	0.25
89_E	109_F	0.759	0.25
69_T	130_L	0.759	0.25
112_L	141_V	0.748	0.25
56_A	131_G	0.743	0.25
102_F	105_I	0.732	0.24
98_T	125_F	0.731	0.24
45_L	120_A	0.724	0.24
54_L	136_G	0.722	0.24
87_G	120_A	0.717	0.23
45_L	48_L	0.712	0.23
81_F	143_M	0.711	0.23
86_K	126_H	0.704	0.23
57_T	116_K	0.701	0.23
29_G	33_L	0.700	0.23
70_A	108_L	0.697	0.23
80_G	107_L	0.689	0.22
104_L	144_R	0.687	0.22
46_T	72_S	0.684	0.22
86_K	138_I	0.682	0.22
51_S	79_G	0.676	0.22
34_Y	47_S	0.676	0.22
45_L	58_S	0.674	0.22
115_G	134_M	0.663	0.21
53_L	139_F	0.661	0.21
110_Q	145_G	0.661	0.21
61_E	74_L	0.659	0.21
31_G	110_Q	0.655	0.21
31_G	72_S	0.638	0.20
80_G	136_G	0.636	0.20
98_T	108_L	0.619	0.19
68_I	83_S	0.619	0.19
32_I	96_A	0.617	0.19
43_M	56_A	0.613	0.19
73_F	85_G	0.611	0.19
39_I	47_S	0.611	0.19
31_G	113_G	0.610	0.19
33_L	40_F	0.608	0.19
71_I	114_F	0.602	0.19
62_S	114_F	0.597	0.19
57_T	81_F	0.592	0.18
45_L	85_G	0.592	0.18
109_F	114_F	0.587	0.18
41_S	89_E	0.587	0.18
36_L	132_V	0.585	0.18
77_F	144_R	0.584	0.18
33_L	131_G	0.582	0.18
78_I	81_F	0.581	0.18
80_G	90_R	0.576	0.18
47_S	84_G	0.561	0.17
52_L	62_S	0.560	0.17
88_K	110_Q	0.560	0.17
36_L	97_L	0.560	0.17
48_L	70_A	0.559	0.17
59_L	81_F	0.556	0.17
46_T	101_S	0.555	0.17
62_S	81_F	0.547	0.17
86_K	113_G	0.546	0.17
92_W	112_L	0.546	0.17
34_Y	110_Q	0.538	0.17
27_Q	97_L	0.536	0.17
32_I	43_M	0.536	0.17
48_L	97_L	0.535	0.17
39_I	133_C	0.535	0.17
90_R	143_M	0.524	0.16
62_S	127_L	0.519	0.16
53_L	59_L	0.518	0.16
87_G	92_W	0.513	0.16
125_F	133_C	0.511	0.16
78_I	82_I	0.506	0.16
74_L	100_L	0.504	0.16
77_F	141_V	0.501	0.15
45_L	104_L	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4ev6A	3	0.5533	46.9	0.928	Contact Map
2xq2A	2	0.8267	31.4	0.935	Contact Map
4i0uA	4	0.54	30	0.935	Contact Map
3dh4A	3	0.8333	28.9	0.936	Contact Map
2i68A	2	0.52	21.2	0.94	Contact Map
4od4A	1	0.8467	19.7	0.941	Contact Map
3o7qA	1	0.7867	18.2	0.941	Contact Map
4m64A	1	0.8267	16.9	0.942	Contact Map
4tq3A	1	0.8267	16.6	0.942	Contact Map
4j05A	3	0.7933	16.1	0.943	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0058 seconds.