COMN - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

COMN - Post-transcriptional regulator ComN

UniProt:	O32049	Sequences: MEKHPADLYKDHVRPFLYSKLEEFKILGYDDVELESLWSYLTDKKWKKKTELSIYELASDILSVKIGEFMNYATVESFKTSNWLGSEEGQEALEELLR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	98 (82)
Sequences:	172 (135)
Seq/√Len:	14.9

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
46_W	72_Y	3.261	0.99
13_V	34_L	3.002	0.98
40_Y	64_V	2.996	0.98
24_F	37_L	2.912	0.97
28_G	78_F	2.211	0.88
74_T	77_S	2.124	0.86
10_K	35_E	2.033	0.84
41_L	46_W	1.748	0.73
13_V	61_I	1.722	0.72
21_L	37_L	1.707	0.71
14_R	34_L	1.672	0.70
48_K	56_E	1.589	0.65
9_Y	73_A	1.564	0.64
54_I	61_I	1.532	0.63
47_K	78_F	1.514	0.62
37_L	64_V	1.507	0.61
67_G	70_M	1.467	0.59
42_T	50_T	1.459	0.59
27_L	73_A	1.459	0.59
9_Y	37_L	1.444	0.58
26_I	64_V	1.395	0.55
30_D	76_E	1.386	0.55
44_K	56_E	1.363	0.53
22_E	58_A	1.330	0.51
13_V	26_I	1.314	0.51
6_A	57_L	1.312	0.50
27_L	69_F	1.279	0.49
27_L	47_K	1.220	0.45
22_E	78_F	1.193	0.44
62_L	86_S	1.191	0.44
78_F	81_S	1.160	0.42
46_W	51_E	1.151	0.42
42_T	55_Y	1.090	0.38
45_K	83_W	1.088	0.38
31_D	73_A	1.084	0.38
19_S	65_K	1.083	0.38
8_L	59_S	1.069	0.37
35_E	56_E	1.056	0.36
76_E	79_K	1.040	0.36
17_L	42_T	1.028	0.35
30_D	58_A	1.026	0.35
28_G	64_V	1.022	0.35
77_S	81_S	1.006	0.34
33_E	54_I	0.989	0.33
46_W	76_E	0.976	0.32
52_L	86_S	0.971	0.32
7_D	42_T	0.963	0.32
64_V	73_A	0.956	0.31
60_D	72_Y	0.953	0.31
82_N	85_G	0.942	0.31
53_S	56_E	0.930	0.30
44_K	60_D	0.928	0.30
37_L	40_Y	0.920	0.30
7_D	66_I	0.920	0.30
6_A	9_Y	0.913	0.29
69_F	73_A	0.907	0.29
10_K	27_L	0.901	0.29
17_L	35_E	0.893	0.29
10_K	57_L	0.869	0.27
18_Y	32_V	0.864	0.27
5_P	9_Y	0.863	0.27
37_L	59_S	0.862	0.27
66_I	71_N	0.846	0.26
18_Y	24_F	0.842	0.26
18_Y	22_E	0.841	0.26
35_E	80_T	0.826	0.26
24_F	66_I	0.804	0.25
29_Y	40_Y	0.803	0.25
7_D	26_I	0.801	0.24
5_P	8_L	0.782	0.24
55_Y	85_G	0.773	0.23
40_Y	73_A	0.757	0.23
7_D	37_L	0.750	0.22
36_S	49_K	0.743	0.22
30_D	80_T	0.736	0.22
31_D	42_T	0.735	0.22
31_D	69_F	0.734	0.22
9_Y	45_K	0.723	0.21
7_D	11_D	0.720	0.21
51_E	57_L	0.717	0.21
72_Y	81_S	0.710	0.21
22_E	67_G	0.707	0.21
65_K	71_N	0.704	0.21
67_G	75_V	0.699	0.21
65_K	69_F	0.692	0.20
25_K	65_K	0.683	0.20
17_L	34_L	0.675	0.20
51_E	62_L	0.669	0.19
18_Y	53_S	0.654	0.19
32_V	63_S	0.652	0.19
17_L	57_L	0.650	0.19
31_D	74_T	0.649	0.19
15_P	76_E	0.629	0.18
26_I	54_I	0.624	0.18
25_K	32_V	0.617	0.18
18_Y	25_K	0.610	0.17
58_A	70_M	0.607	0.17
45_K	52_L	0.605	0.17
30_D	71_N	0.603	0.17
8_L	35_E	0.594	0.17
17_L	77_S	0.589	0.17
26_I	78_F	0.589	0.17
44_K	74_T	0.588	0.17
41_L	74_T	0.584	0.17
40_Y	54_I	0.581	0.17
21_L	34_L	0.578	0.16
60_D	70_M	0.578	0.16
5_P	70_M	0.578	0.16
25_K	30_D	0.578	0.16
21_L	64_V	0.565	0.16
19_S	26_I	0.562	0.16
11_D	35_E	0.552	0.16
21_L	70_M	0.548	0.16
39_S	75_V	0.547	0.16
43_D	46_W	0.544	0.15
66_I	86_S	0.539	0.15
24_F	86_S	0.528	0.15
17_L	51_E	0.523	0.15
26_I	56_E	0.516	0.15
5_P	54_I	0.516	0.15
49_K	79_K	0.512	0.15
8_L	86_S	0.509	0.14
14_R	47_K	0.500	0.14

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4oavB	2	0.8163	23.7	0.923	Contact Map
3vx8D	1	0.9184	8.7	0.936	Contact Map
4zuzA	1	0.9286	8.4	0.937	Contact Map
3t7hA	1	0.9388	7.3	0.939	Contact Map
4akgA	2	0.8571	6.2	0.941	Contact Map
3vkgA	2	0.8878	6	0.941	Contact Map
1t7lA	1	0.7143	5.8	0.941	Contact Map
2c9wA	1	0.3265	4.6	0.944	Contact Map
3vx6A	2	0.8878	4.5	0.945	Contact Map
4ddgA	3	0.9592	4.4	0.945	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0054 seconds.