DTD - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

DTD - Putative D-aminoacyl-tRNA deacylase-like protein

UniProt:	O32042	Sequences: KRLVVQRVTEASVTVDEEVVGQIGQGLMVLVGITHDDTEDDAAYLADKVVNLRIFDDSEGKMNLSLVDIGGEILSVSQFTLYGDTKKGRRPNYMNAAKPDKALGLYEKWNDLLREKGIKVETGTFGAMMDVQLTNSGPVTLIMDSK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	146 (143)
Sequences:	3489 (2382)
Seq/√Len:	199.2

ECOLI - DTD
BACSU - DTD

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
4_V	142_I	2.623	1.00
10_E	132_Q	2.585	1.00
43_A	112_L	2.506	1.00
110_N	122_T	2.474	1.00
39_E	108_K	2.285	1.00
15_V	20_V	2.246	1.00
42_A	108_K	2.142	1.00
27_L	54_I	2.083	1.00
103_L	107_E	2.082	1.00
112_L	115_E	2.071	1.00
51_N	89_R	2.060	1.00
18_E	124_T	1.971	1.00
65_S	68_D	1.958	1.00
75_S	110_N	1.936	1.00
20_V	124_T	1.899	1.00
10_E	134_T	1.824	1.00
38_T	41_D	1.799	1.00
21_G	121_E	1.750	1.00
3_L	29_V	1.710	1.00
101_K	104_G	1.700	1.00
9_T	130_D	1.699	1.00
28_M	133_L	1.679	1.00
34_T	82_Y	1.677	1.00
73_I	113_L	1.646	1.00
47_D	51_N	1.638	1.00
62_M	139_V	1.628	1.00
8_V	28_M	1.627	1.00
11_A	28_M	1.615	1.00
75_S	109_W	1.615	1.00
12_S	132_Q	1.590	1.00
13_V	131_V	1.506	1.00
14_T	132_Q	1.501	1.00
46_A	113_L	1.446	1.00
57_D	63_N	1.419	1.00
27_L	66_L	1.395	1.00
19_V	22_Q	1.394	1.00
14_T	19_V	1.388	1.00
61_K	93_Y	1.384	1.00
72_E	119_K	1.383	1.00
43_A	108_K	1.358	1.00
3_L	31_V	1.344	1.00
130_D	134_T	1.333	1.00
35_H	95_N	1.333	1.00
30_L	133_L	1.332	1.00
3_L	49_V	1.328	1.00
111_D	115_E	1.317	1.00
66_L	71_G	1.264	1.00
130_D	136_S	1.258	1.00
29_V	49_V	1.254	1.00
66_L	73_I	1.225	1.00
25_Q	69_I	1.208	1.00
35_H	98_K	1.202	1.00
84_D	95_N	1.199	1.00
111_D	114_R	1.180	1.00
75_S	113_L	1.172	1.00
58_S	64_L	1.169	1.00
47_D	116_K	1.169	1.00
24_G	72_E	1.166	1.00
108_K	112_L	1.166	1.00
85_T	143_M	1.153	1.00
114_R	122_T	1.152	1.00
66_L	118_I	1.146	1.00
83_G	141_L	1.145	1.00
46_A	112_L	1.137	1.00
41_D	44_Y	1.135	1.00
35_H	97_A	1.135	1.00
75_S	106_Y	1.125	1.00
9_T	134_T	1.124	1.00
12_S	22_Q	1.119	1.00
56_D	93_Y	1.113	1.00
77_S	106_Y	1.113	1.00
107_E	111_D	1.110	1.00
51_N	67_V	1.103	1.00
56_D	60_G	1.094	1.00
40_D	43_A	1.090	1.00
31_V	109_W	1.072	1.00
11_A	133_L	1.069	1.00
97_A	101_K	1.060	1.00
42_A	105_L	1.055	1.00
49_V	109_W	1.047	1.00
50_V	118_I	1.034	1.00
39_E	43_A	1.024	1.00
2_R	82_Y	1.008	1.00
9_T	136_S	1.007	1.00
39_E	104_G	0.993	1.00
2_R	142_I	0.988	1.00
34_T	95_N	0.971	0.99
21_G	74_L	0.967	0.99
67_V	116_K	0.963	0.99
42_A	112_L	0.962	0.99
98_K	101_K	0.957	0.99
50_V	113_L	0.957	0.99
103_L	124_T	0.956	0.99
46_A	116_K	0.953	0.99
47_D	89_R	0.938	0.99
6_Q	133_L	0.932	0.99
35_H	101_K	0.926	0.99
42_A	45_L	0.925	0.99
29_V	75_S	0.922	0.99
72_E	121_E	0.918	0.99
36_D	101_K	0.895	0.99
56_D	61_K	0.895	0.99
64_L	67_V	0.886	0.99
14_T	130_D	0.879	0.99
2_R	144_D	0.877	0.99
108_K	111_D	0.870	0.99
107_E	122_T	0.857	0.99
50_V	116_K	0.851	0.99
100_D	103_L	0.849	0.99
110_N	114_R	0.845	0.99
28_M	76_V	0.843	0.99
101_K	105_L	0.841	0.98
32_G	82_Y	0.840	0.98
124_T	127_A	0.837	0.98
64_L	68_D	0.837	0.98
50_V	73_I	0.835	0.98
128_M	136_S	0.832	0.98
33_I	42_A	0.830	0.98
3_L	45_L	0.829	0.98
112_L	116_K	0.819	0.98
31_V	75_S	0.814	0.98
33_I	97_A	0.807	0.98
43_A	47_D	0.804	0.98
74_L	121_E	0.792	0.98
43_A	46_A	0.792	0.98
36_D	41_D	0.785	0.98
25_Q	136_S	0.781	0.98
21_G	76_V	0.778	0.98
25_Q	56_D	0.769	0.97
41_D	144_D	0.754	0.97
34_T	144_D	0.747	0.97
78_Q	81_L	0.742	0.97
33_I	45_L	0.736	0.97
12_S	19_V	0.732	0.96
39_E	112_L	0.726	0.96
114_R	119_K	0.719	0.96
42_A	46_A	0.700	0.95
15_V	124_T	0.698	0.95
131_V	135_N	0.690	0.95
36_D	97_A	0.688	0.95
30_L	140_T	0.686	0.95
84_D	92_N	0.682	0.95
45_L	109_W	0.680	0.95
84_D	94_M	0.674	0.94
16_D	124_T	0.670	0.94
13_V	20_V	0.669	0.94
5_V	49_V	0.669	0.94
64_L	69_I	0.668	0.94
44_Y	83_G	0.655	0.93
15_V	21_G	0.655	0.93
113_L	120_V	0.650	0.93
109_W	113_L	0.646	0.93
82_Y	144_D	0.636	0.92
8_V	24_G	0.631	0.92
98_K	104_G	0.630	0.92
9_T	25_Q	0.630	0.92
53_R	90_R	0.624	0.92
52_L	85_T	0.623	0.92
44_Y	47_D	0.622	0.92
46_A	50_V	0.622	0.92
67_V	70_G	0.622	0.92
42_A	109_W	0.621	0.92
13_V	76_V	0.618	0.91
23_I	121_E	0.613	0.91
52_L	141_L	0.612	0.91
53_R	63_N	0.610	0.91
4_V	30_L	0.609	0.91
16_D	127_A	0.608	0.91
102_A	125_F	0.607	0.91
45_L	143_M	0.606	0.91
41_D	45_L	0.604	0.90
7_R	139_V	0.600	0.90
72_E	118_I	0.599	0.90
31_V	106_Y	0.594	0.90
104_G	108_K	0.593	0.90
52_L	143_M	0.587	0.89
63_N	92_N	0.586	0.89
66_L	69_I	0.584	0.89
5_V	143_M	0.583	0.89
3_L	109_W	0.581	0.89
103_L	126_G	0.581	0.89
49_V	75_S	0.581	0.89
29_V	73_I	0.574	0.88
27_L	73_I	0.574	0.88
36_D	82_Y	0.572	0.88
47_D	112_L	0.569	0.88
16_D	19_V	0.566	0.87
48_K	52_L	0.562	0.87
32_G	96_A	0.557	0.87
8_V	23_I	0.553	0.86
70_G	118_I	0.553	0.86
27_L	93_Y	0.551	0.86
7_R	136_S	0.551	0.86
55_F	71_G	0.549	0.86
106_Y	109_W	0.537	0.84
97_A	102_A	0.536	0.84
40_D	44_Y	0.535	0.84
10_E	130_D	0.534	0.84
141_L	144_D	0.534	0.84
32_G	142_I	0.534	0.84
38_T	105_L	0.533	0.84
92_N	95_N	0.531	0.84
82_Y	96_A	0.531	0.84
130_D	133_L	0.529	0.84
99_P	126_G	0.527	0.83
38_T	42_A	0.516	0.82
86_K	144_D	0.516	0.82
30_L	131_V	0.511	0.81
60_G	64_L	0.510	0.81
85_T	141_L	0.509	0.81
44_Y	48_K	0.507	0.81
22_Q	121_E	0.504	0.81
106_Y	110_N	0.500	0.80
20_V	76_V	0.500	0.80

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2dboA	2	1	100	0.048	Contact Map
1jkeA	5	0.9932	100	0.054	Contact Map
1j7gA	2	0.9863	100	0.058	Contact Map
2okvA	2	0.9932	100	0.067	Contact Map
4nbiA	2	1	100	0.069	Contact Map
1tc5A	2	0.9795	100	0.152	Contact Map
4rrqA	2	0.8288	44.4	0.945	Contact Map
4rriA	2	0.8288	44.3	0.945	Contact Map
4rrfA	2	0.8288	35.9	0.948	Contact Map
2g5xA	1	0.363	33.9	0.949	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0064 seconds.