YQZC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQZC - Uncharacterized protein YqzC

UniProt:	O32023	Sequences: MTKRGIQAFAGGIILATAVLAAVFYLTDEDQAAAVKDNKTVTEQDVNNYLDSKKLVSVNRDEYQKLLDSKEKSLNNDSGSDTKSDKVKTYKLTIKDGMSTADVSAILEKEGIISSAQDFNDYVIDAGYHKEIRAGEFKVKSDMSFKKIVKTLTR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	154 (150)
Sequences:	278 (272)
Seq/√Len:	22.2

BACSU - YQZC

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
139_V	143_M	3.661	1.00
115_S	118_D	3.474	1.00
123_V	149_V	3.407	1.00
140_K	143_M	3.357	1.00
92_L	112_I	2.835	0.99
122_Y	128_Y	2.806	0.99
98_M	106_I	2.791	0.99
128_Y	149_V	2.467	0.98
105_A	116_A	2.447	0.98
122_Y	149_V	2.443	0.98
144_S	147_K	2.344	0.97
50_L	54_K	2.178	0.96
5_G	8_A	2.132	0.95
4_R	10_A	2.088	0.94
139_V	148_I	2.072	0.94
149_V	153_T	2.055	0.94
113_I	116_A	1.963	0.92
143_M	147_K	1.956	0.92
46_V	49_Y	1.895	0.91
4_R	8_A	1.829	0.89
126_A	149_V	1.782	0.88
104_S	153_T	1.776	0.88
63_Y	66_L	1.762	0.87
137_F	152_L	1.757	0.87
104_S	120_N	1.642	0.83
31_Q	40_T	1.604	0.82
114_S	118_D	1.515	0.78
122_Y	126_A	1.514	0.78
19_V	45_D	1.486	0.76
17_T	24_F	1.462	0.75
100_T	120_N	1.446	0.74
89_T	138_K	1.390	0.71
92_L	113_I	1.383	0.71
92_L	95_K	1.346	0.69
7_Q	122_Y	1.334	0.68
146_K	149_V	1.329	0.68
98_M	112_I	1.318	0.67
9_F	13_I	1.281	0.65
48_N	73_S	1.276	0.65
22_A	127_G	1.247	0.63
90_Y	132_I	1.230	0.62
35_V	40_T	1.222	0.61
50_L	55_L	1.203	0.60
103_V	152_L	1.202	0.60
13_I	19_V	1.202	0.60
96_D	137_F	1.200	0.60
31_Q	36_K	1.196	0.59
3_K	7_Q	1.180	0.58
8_A	94_I	1.180	0.58
124_I	129_H	1.179	0.58
5_G	10_A	1.179	0.58
65_K	85_D	1.173	0.58
8_A	13_I	1.165	0.57
140_K	151_T	1.156	0.57
98_M	134_A	1.139	0.56
33_A	37_D	1.133	0.55
87_V	141_S	1.104	0.53
128_Y	150_K	1.102	0.53
31_Q	37_D	1.101	0.53
127_G	147_K	1.096	0.53
132_I	148_I	1.080	0.52
9_F	18_A	1.051	0.50
37_D	40_T	1.045	0.49
48_N	140_K	1.042	0.49
13_I	16_A	1.039	0.49
105_A	109_K	1.035	0.49
10_A	141_S	1.021	0.48
21_A	24_F	1.012	0.47
93_T	137_F	0.996	0.46
4_R	33_A	0.988	0.45
36_K	39_K	0.984	0.45
101_A	120_N	0.977	0.45
44_Q	52_S	0.971	0.44
8_A	100_T	0.969	0.44
61_D	77_D	0.956	0.43
123_V	128_Y	0.945	0.42
104_S	148_I	0.934	0.42
13_I	17_T	0.931	0.42
12_G	16_A	0.930	0.41
28_D	121_D	0.928	0.41
78_S	82_T	0.922	0.41
95_K	125_D	0.921	0.41
8_A	16_A	0.914	0.40
103_V	134_A	0.911	0.40
114_S	145_F	0.911	0.40
113_I	144_S	0.910	0.40
12_G	119_F	0.909	0.40
24_F	143_M	0.907	0.40
66_L	114_S	0.905	0.40
11_G	99_S	0.901	0.40
26_L	143_M	0.897	0.39
66_L	70_K	0.896	0.39
4_R	103_V	0.894	0.39
95_K	98_M	0.894	0.39
7_Q	123_V	0.886	0.39
32_A	36_K	0.885	0.39
33_A	36_K	0.879	0.38
71_E	75_N	0.877	0.38
94_I	97_G	0.870	0.38
132_I	152_L	0.868	0.37
112_I	143_M	0.867	0.37
94_I	113_I	0.866	0.37
103_V	144_S	0.860	0.37
74_L	78_S	0.855	0.37
102_D	113_I	0.853	0.36
16_A	139_V	0.853	0.36
123_V	146_K	0.847	0.36
53_K	73_S	0.839	0.36
69_S	73_S	0.839	0.36
90_Y	109_K	0.838	0.36
14_I	143_M	0.824	0.35
3_K	123_V	0.821	0.34
88_K	141_S	0.818	0.34
98_M	102_D	0.816	0.34
20_L	111_G	0.816	0.34
10_A	98_M	0.811	0.34
62_E	107_L	0.809	0.34
10_A	25_Y	0.809	0.34
13_I	99_S	0.803	0.33
133_R	137_F	0.800	0.33
72_K	78_S	0.799	0.33
103_V	133_R	0.796	0.33
44_Q	112_I	0.784	0.32
20_L	24_F	0.783	0.32
120_N	124_I	0.776	0.32
119_F	145_F	0.770	0.31
61_D	64_Q	0.770	0.31
46_V	53_K	0.769	0.31
94_I	152_L	0.767	0.31
7_Q	11_G	0.766	0.31
35_V	85_D	0.766	0.31
100_T	123_V	0.765	0.31
9_F	16_A	0.759	0.31
45_D	54_K	0.758	0.31
33_A	40_T	0.756	0.31
146_K	150_K	0.754	0.30
65_K	72_K	0.745	0.30
92_L	131_E	0.744	0.30
6_I	151_T	0.743	0.30
48_N	142_D	0.731	0.29
60_R	68_D	0.728	0.29
11_G	17_T	0.726	0.29
22_A	36_K	0.725	0.29
105_A	152_L	0.715	0.28
40_T	152_L	0.714	0.28
95_K	134_A	0.704	0.28
46_V	54_K	0.703	0.28
98_M	103_V	0.703	0.28
90_Y	112_I	0.702	0.28
5_G	33_A	0.695	0.27
14_I	126_A	0.694	0.27
56_V	60_R	0.694	0.27
123_V	145_F	0.690	0.27
17_T	139_V	0.689	0.27
103_V	123_V	0.682	0.26
57_S	61_D	0.680	0.26
4_R	108_E	0.677	0.26
108_E	116_A	0.671	0.26
139_V	151_T	0.667	0.26
41_V	45_D	0.663	0.25
38_N	139_V	0.663	0.25
9_F	20_L	0.663	0.25
7_Q	149_V	0.662	0.25
9_F	92_L	0.656	0.25
122_Y	146_K	0.654	0.25
31_Q	39_K	0.654	0.25
97_G	103_V	0.650	0.25
53_K	72_K	0.647	0.25
113_I	135_G	0.645	0.25
19_V	22_A	0.643	0.24
3_K	16_A	0.643	0.24
86_K	145_F	0.643	0.24
33_A	39_K	0.639	0.24
104_S	145_F	0.632	0.24
130_K	146_K	0.631	0.24
114_S	130_K	0.627	0.24
109_K	132_I	0.626	0.24
5_G	13_I	0.625	0.24
36_K	40_T	0.621	0.23
7_Q	92_L	0.620	0.23
18_A	90_Y	0.619	0.23
43_E	69_S	0.618	0.23
3_K	122_Y	0.618	0.23
72_K	142_D	0.618	0.23
7_Q	93_T	0.616	0.23
8_A	90_Y	0.615	0.23
34_A	79_G	0.606	0.23
132_I	149_V	0.605	0.23
64_Q	125_D	0.601	0.22
114_S	138_K	0.597	0.22
93_T	148_I	0.593	0.22
20_L	99_S	0.592	0.22
107_L	135_G	0.591	0.22
66_L	77_D	0.589	0.22
61_D	65_K	0.582	0.22
21_A	60_R	0.581	0.21
13_I	98_M	0.576	0.21
138_K	145_F	0.575	0.21
92_L	137_F	0.573	0.21
19_V	133_R	0.570	0.21
32_A	35_V	0.565	0.21
61_D	70_K	0.565	0.21
110_E	136_E	0.564	0.21
96_D	104_S	0.561	0.21
76_N	82_T	0.560	0.21
64_Q	113_I	0.557	0.20
22_A	26_L	0.552	0.20
127_G	150_K	0.550	0.20
92_L	106_I	0.544	0.20
123_V	132_I	0.538	0.20
28_D	65_K	0.535	0.19
43_E	68_D	0.535	0.19
9_F	136_E	0.534	0.19
64_Q	134_A	0.530	0.19
92_L	138_K	0.527	0.19
94_I	150_K	0.522	0.19
10_A	143_M	0.522	0.19
46_V	50_L	0.522	0.19
17_T	20_L	0.521	0.19
6_I	37_D	0.520	0.19
74_L	144_S	0.516	0.19
80_S	83_K	0.516	0.19
72_K	75_N	0.510	0.18
143_M	151_T	0.506	0.18
128_Y	146_K	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4iiwA	4	0.4416	99	0.692	Contact Map
2r1fA	4	0.6104	92.8	0.859	Contact Map
4xcmA	2	0.3701	31.2	0.917	Contact Map
4uz3A	1	0.3766	24.1	0.922	Contact Map
3gmxB	2	0.4675	21.8	0.923	Contact Map
3gmvX	1	0.461	19.1	0.925	Contact Map
3d4eA	1	0.4805	18.5	0.926	Contact Map
5a2fA	1	0	16.6	0.927	Contact Map
2nycA	2	0.526	12.6	0.931	Contact Map
4ebyA	1	0.4481	12.4	0.931	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.