YQZF - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YQZF - Uncharacterized protein YqzF

UniProt:	O32015	Sequences: MSRLLALLILVIPGAISALGIKLMRDTLFGHTIKPFSALWLQGLSGFIFFAIGLYVLAGFILYRDRKRNQVSPRFRKR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	78 (76)
Sequences:	186 (137)
Seq/√Len:	15.7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
5_L	9_I	4.096	1.00
24_M	43_G	3.975	1.00
24_M	47_F	3.186	0.99
57_L	62_L	2.505	0.95
3_R	65_D	2.212	0.90
50_F	54_L	2.023	0.85
14_G	18_A	1.929	0.82
22_K	25_R	1.886	0.81
60_F	70_Q	1.849	0.79
36_F	45_S	1.817	0.78
53_G	64_R	1.738	0.75
23_L	63_Y	1.601	0.68
62_L	66_R	1.547	0.66
25_R	60_F	1.537	0.65
16_I	77_K	1.490	0.63
27_T	33_I	1.486	0.62
8_L	14_G	1.436	0.60
7_L	11_V	1.387	0.57
15_A	61_I	1.368	0.56
28_L	48_I	1.361	0.55
19_L	61_I	1.356	0.55
33_I	58_A	1.342	0.54
43_G	56_V	1.306	0.52
25_R	70_Q	1.273	0.50
52_I	58_A	1.270	0.50
51_A	54_L	1.219	0.47
10_L	64_R	1.197	0.46
15_A	44_L	1.195	0.46
42_Q	45_S	1.180	0.45
66_R	76_R	1.151	0.43
18_A	72_S	1.140	0.43
41_L	45_S	1.140	0.43
22_K	60_F	1.094	0.40
15_A	19_L	1.056	0.38
47_F	54_L	1.049	0.38
40_W	44_L	1.031	0.37
7_L	58_A	1.014	0.36
4_L	27_T	0.991	0.35
63_Y	67_K	0.964	0.33
31_H	35_P	0.959	0.33
19_L	23_L	0.952	0.33
21_I	42_Q	0.947	0.32
71_V	75_F	0.941	0.32
33_I	41_L	0.928	0.31
4_L	73_P	0.909	0.30
35_P	42_Q	0.890	0.30
17_S	75_F	0.884	0.29
21_I	35_P	0.869	0.29
8_L	48_I	0.861	0.28
48_I	71_V	0.854	0.28
31_H	70_Q	0.844	0.27
3_R	14_G	0.841	0.27
4_L	54_L	0.834	0.27
7_L	22_K	0.823	0.26
40_W	45_S	0.818	0.26
62_L	75_F	0.802	0.26
50_F	61_I	0.800	0.25
12_I	49_F	0.799	0.25
3_R	60_F	0.797	0.25
57_L	72_S	0.792	0.25
33_I	55_Y	0.790	0.25
21_I	60_F	0.784	0.25
7_L	61_I	0.782	0.25
28_L	41_L	0.757	0.24
10_L	14_G	0.753	0.23
8_L	49_F	0.752	0.23
61_I	69_N	0.744	0.23
32_T	39_L	0.722	0.22
21_I	25_R	0.719	0.22
8_L	61_I	0.710	0.22
18_A	68_R	0.704	0.21
19_L	28_L	0.703	0.21
6_A	17_S	0.697	0.21
9_I	74_R	0.690	0.21
19_L	36_F	0.671	0.20
66_R	69_N	0.670	0.20
24_M	50_F	0.656	0.20
10_L	57_L	0.650	0.19
49_F	56_V	0.647	0.19
3_R	70_Q	0.646	0.19
32_T	35_P	0.635	0.19
19_L	33_I	0.626	0.19
22_K	42_Q	0.620	0.18
57_L	61_I	0.619	0.18
39_L	52_I	0.612	0.18
62_L	69_N	0.608	0.18
23_L	29_F	0.607	0.18
52_I	55_Y	0.606	0.18
62_L	71_V	0.605	0.18
16_I	48_I	0.604	0.18
60_F	63_Y	0.602	0.18
11_V	14_G	0.590	0.17
11_V	21_I	0.587	0.17
16_I	33_I	0.585	0.17
10_L	27_T	0.583	0.17
22_K	36_F	0.578	0.17
41_L	73_P	0.572	0.17
15_A	73_P	0.565	0.17
20_G	46_G	0.553	0.16
38_A	47_F	0.548	0.16
30_G	42_Q	0.544	0.16
10_L	40_W	0.542	0.16
71_V	77_K	0.541	0.16
4_L	72_S	0.532	0.16
65_D	68_R	0.525	0.15
2_S	48_I	0.524	0.15
10_L	56_V	0.523	0.15
51_A	55_Y	0.519	0.15
43_G	72_S	0.514	0.15
25_R	63_Y	0.514	0.15
60_F	65_D	0.513	0.15
62_L	72_S	0.508	0.15
40_W	75_F	0.506	0.15
3_R	53_G	0.500	0.15

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2kluA	1	0.5641	27.1	0.909	Contact Map
2yevB	1	0.7179	13	0.922	Contact Map
4bbjA	1	0.8718	11.6	0.923	Contact Map
2mfrA	1	0.6667	6.8	0.931	Contact Map
4a2nB	1	0.8846	5.2	0.934	Contact Map
2m20A	2	0.5385	5.1	0.935	Contact Map
3j08A	2	0.7821	4.4	0.937	Contact Map
1lnqA	6	0.6538	4.1	0.938	Contact Map
4j7cI	2	0.9872	4.1	0.938	Contact Map
4tkrA	2	0.9487	3.8	0.939	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0043 seconds.