YOZE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YOZE - UPF0346 protein YozE

UniProt:	O31864	Sequences: MKSFYHYLLKYRHPKPKDSISEFANQAYEDHSFPKTSTDYHEISSYLELNADYLHTMATFDEAWDQYESEVHGR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	74 (69)
Sequences:	250 (170)
Seq/√Len:	20.4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
8_L	27_A	3.493	1.00
37_S	42_E	3.444	1.00
40_Y	49_L	2.129	0.94
13_H	21_S	2.100	0.93
23_F	53_Y	2.077	0.93
2_K	10_K	2.052	0.92
8_L	23_F	1.830	0.87
23_F	27_A	1.806	0.86
54_L	59_T	1.801	0.86
9_L	27_A	1.756	0.85
2_K	36_T	1.658	0.81
20_I	63_A	1.623	0.80
41_H	45_S	1.613	0.79
37_S	64_W	1.566	0.77
25_N	53_Y	1.555	0.77
16_P	21_S	1.481	0.73
23_F	54_L	1.462	0.72
12_R	28_Y	1.444	0.71
37_S	43_I	1.430	0.70
30_D	46_Y	1.403	0.69
11_Y	31_H	1.377	0.67
8_L	14_P	1.288	0.62
22_E	26_Q	1.271	0.61
40_Y	64_W	1.254	0.60
58_A	69_S	1.225	0.58
7_Y	11_Y	1.220	0.58
38_T	70_E	1.174	0.55
20_I	66_Q	1.168	0.54
40_Y	45_S	1.167	0.54
6_H	31_H	1.131	0.52
43_I	64_W	1.116	0.51
7_Y	15_K	1.116	0.51
53_Y	57_M	1.114	0.51
9_L	28_Y	1.108	0.50
13_H	16_P	1.020	0.45
26_Q	55_H	1.004	0.44
2_K	7_Y	1.003	0.43
28_Y	32_S	0.994	0.43
40_Y	70_E	0.973	0.42
38_T	68_E	0.968	0.41
17_K	21_S	0.965	0.41
7_Y	52_D	0.953	0.40
14_P	25_N	0.946	0.40
13_H	36_T	0.946	0.40
50_N	54_L	0.925	0.39
10_K	36_T	0.904	0.37
26_Q	56_T	0.902	0.37
38_T	66_Q	0.895	0.37
15_K	38_T	0.867	0.35
6_H	42_E	0.865	0.35
18_D	30_D	0.862	0.35
52_D	66_Q	0.852	0.34
51_A	56_T	0.843	0.34
9_L	67_Y	0.822	0.32
3_S	6_H	0.814	0.32
54_L	57_M	0.807	0.32
4_F	48_E	0.795	0.31
14_P	18_D	0.759	0.29
2_K	52_D	0.755	0.29
23_F	49_L	0.746	0.28
18_D	21_S	0.738	0.28
39_D	42_E	0.725	0.27
26_Q	53_Y	0.725	0.27
62_E	65_D	0.724	0.27
12_R	38_T	0.719	0.27
35_K	43_I	0.688	0.25
29_E	39_D	0.684	0.25
31_H	70_E	0.669	0.24
11_Y	40_Y	0.659	0.24
3_S	22_E	0.645	0.23
53_Y	63_A	0.643	0.23
8_L	25_N	0.643	0.23
16_P	41_H	0.635	0.23
19_S	22_E	0.624	0.22
12_R	47_L	0.622	0.22
11_Y	70_E	0.615	0.22
59_T	62_E	0.614	0.22
25_N	36_T	0.613	0.22
38_T	69_S	0.603	0.21
27_A	58_A	0.602	0.21
10_K	20_I	0.588	0.21
14_P	23_F	0.586	0.20
58_A	65_D	0.578	0.20
19_S	57_M	0.577	0.20
44_S	48_E	0.577	0.20
12_R	15_K	0.573	0.20
11_Y	66_Q	0.568	0.20
50_N	59_T	0.564	0.20
43_I	55_H	0.562	0.19
32_S	70_E	0.558	0.19
28_Y	31_H	0.553	0.19
16_P	36_T	0.552	0.19
40_Y	69_S	0.550	0.19
65_D	69_S	0.550	0.19
17_K	41_H	0.548	0.19
4_F	47_L	0.546	0.19
55_H	68_E	0.544	0.19
39_D	45_S	0.537	0.18
10_K	28_Y	0.523	0.18
28_Y	70_E	0.516	0.18
19_S	41_H	0.514	0.18
40_Y	55_H	0.506	0.17
3_S	14_P	0.504	0.17
13_H	26_Q	0.500	0.17

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2fj6A	1	1	100	0.235	Contact Map
2o6kA	1	0.9459	99.9	0.322	Contact Map
2kvsA	1	0.973	99.7	0.53	Contact Map
3i1aA	1	0.8108	10.3	0.93	Contact Map
3ax1A	1	0.7027	7.6	0.934	Contact Map
2dtgE	2	0.8649	6.1	0.937	Contact Map
3vtxA	2	0.5676	5.5	0.938	Contact Map
3hncA	2	0.8784	5.5	0.938	Contact Map
2wghA	2	0.8784	5.4	0.938	Contact Map
3k8tA	2	0.8784	4.8	0.939	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0042 seconds.