YOJF - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YOJF - Uncharacterized protein YojF

UniProt:	O31858	Sequences: MKAIIKEDVQASLERYADRPVYIHLETTTGSYSAHLNEKNMTVVAYIRNAKVTYHQAKIKGNGPYRVGLKTEEGWIYAEGLTEYTVDEENRLLMAGHLPGGKLAISLQISEKPFTV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	116 (114)
Sequences:	199 (136)
Seq/√Len:	12.7

BACSU - YOJF

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
19_R	111_E	5.345	1.00
87_D	91_R	4.288	1.00
52_V	76_I	4.175	1.00
4_I	81_L	3.920	0.99
9_V	59_I	3.261	0.98
13_L	57_A	3.030	0.97
21_V	109_I	2.763	0.94
20_P	51_K	2.563	0.91
20_P	53_T	2.379	0.88
25_L	78_A	2.290	0.86
45_A	78_A	2.259	0.85
25_L	47_I	1.968	0.76
14_E	54_Y	1.958	0.75
23_I	76_I	1.890	0.73
40_N	43_V	1.830	0.70
43_V	83_E	1.817	0.70
2_K	22_Y	1.754	0.67
63_G	79_E	1.735	0.66
67_V	94_M	1.734	0.66
98_L	102_K	1.717	0.65
83_E	102_K	1.574	0.58
5_I	8_D	1.439	0.51
64_P	104_A	1.426	0.50
41_M	104_A	1.316	0.45
29_T	48_R	1.311	0.45
54_Y	109_I	1.216	0.40
55_H	72_E	1.207	0.39
56_Q	76_I	1.204	0.39
64_P	83_E	1.190	0.38
13_L	99_P	1.165	0.37
27_T	93_L	1.164	0.37
25_L	45_A	1.153	0.37
46_Y	73_E	1.127	0.35
17_A	57_A	1.119	0.35
79_E	97_H	1.119	0.35
23_I	53_T	1.117	0.35
87_D	90_N	1.109	0.35
59_I	79_E	1.088	0.34
17_A	54_Y	1.075	0.33
27_T	48_R	1.073	0.33
44_V	105_I	1.063	0.32
60_K	64_P	1.021	0.31
65_Y	81_L	1.009	0.30
70_K	92_L	1.004	0.30
31_S	97_H	1.001	0.30
78_A	105_I	0.999	0.30
16_Y	90_N	0.999	0.30
40_N	104_A	0.997	0.30
29_T	42_T	0.994	0.29
13_L	50_A	0.994	0.29
81_L	100_G	0.994	0.29
51_K	72_E	0.990	0.29
21_V	53_T	0.977	0.29
38_E	55_H	0.977	0.29
40_N	102_K	0.955	0.28
56_Q	81_L	0.947	0.27
29_T	44_V	0.934	0.27
12_S	86_V	0.932	0.27
16_Y	21_V	0.932	0.27
43_V	102_K	0.910	0.26
27_T	45_A	0.902	0.26
6_K	52_V	0.890	0.25
28_T	35_H	0.886	0.25
5_I	109_I	0.869	0.24
31_S	105_I	0.860	0.24
57_A	69_L	0.845	0.23
73_E	106_S	0.839	0.23
29_T	93_L	0.838	0.23
38_E	42_T	0.838	0.23
27_T	44_V	0.834	0.23
4_I	63_G	0.831	0.23
64_P	82_T	0.830	0.23
46_Y	51_K	0.829	0.23
14_E	17_A	0.828	0.23
59_I	63_G	0.825	0.23
29_T	33_S	0.816	0.22
12_S	108_Q	0.812	0.22
77_Y	110_S	0.811	0.22
13_L	20_P	0.796	0.22
41_M	64_P	0.794	0.22
31_S	79_E	0.794	0.22
16_Y	20_P	0.793	0.22
83_E	100_G	0.791	0.21
22_Y	109_I	0.790	0.21
41_M	102_K	0.783	0.21
16_Y	87_D	0.773	0.21
11_A	88_E	0.773	0.21
25_L	105_I	0.771	0.21
44_V	78_A	0.768	0.21
45_A	95_A	0.766	0.21
60_K	109_I	0.763	0.21
48_R	93_L	0.752	0.20
15_R	59_I	0.748	0.20
83_E	105_I	0.743	0.20
27_T	104_A	0.742	0.20
83_E	97_H	0.739	0.20
16_Y	112_K	0.739	0.20
67_V	107_L	0.738	0.20
23_I	50_A	0.735	0.20
19_R	76_I	0.733	0.20
7_E	11_A	0.728	0.19
69_L	107_L	0.726	0.19
39_K	43_V	0.725	0.19
9_V	73_E	0.720	0.19
23_I	109_I	0.716	0.19
95_A	103_L	0.715	0.19
33_S	44_V	0.701	0.19
38_E	51_K	0.692	0.18
41_M	83_E	0.673	0.18
51_K	73_E	0.672	0.18
2_K	53_T	0.666	0.17
2_K	8_D	0.659	0.17
2_K	20_P	0.656	0.17
59_I	94_M	0.654	0.17
11_A	15_R	0.653	0.17
2_K	112_K	0.648	0.17
40_N	64_P	0.646	0.17
60_K	93_L	0.643	0.17
63_G	81_L	0.640	0.17
6_K	67_V	0.639	0.17
18_D	39_K	0.635	0.17
88_E	108_Q	0.633	0.16
38_E	47_I	0.631	0.16
11_A	99_P	0.630	0.16
87_D	93_L	0.628	0.16
27_T	40_N	0.628	0.16
54_Y	70_K	0.628	0.16
2_K	84_Y	0.625	0.16
65_Y	79_E	0.618	0.16
7_E	62_N	0.613	0.16
4_I	56_Q	0.609	0.16
5_I	76_I	0.606	0.16
67_V	90_N	0.605	0.16
44_V	98_L	0.602	0.16
13_L	17_A	0.602	0.16
99_P	109_I	0.600	0.16
77_Y	80_G	0.598	0.16
13_L	76_I	0.594	0.15
43_V	56_Q	0.591	0.15
51_K	88_E	0.586	0.15
34_A	39_K	0.585	0.15
20_P	89_E	0.584	0.15
4_I	65_Y	0.568	0.15
68_G	77_Y	0.566	0.15
8_D	65_Y	0.565	0.15
7_E	67_V	0.565	0.15
7_E	14_E	0.558	0.14
90_N	111_E	0.556	0.14
9_V	79_E	0.555	0.14
56_Q	65_Y	0.554	0.14
97_H	103_L	0.553	0.14
39_K	72_E	0.552	0.14
72_E	108_Q	0.549	0.14
7_E	37_N	0.540	0.14
62_N	88_E	0.539	0.14
59_I	65_Y	0.530	0.14
46_Y	91_R	0.530	0.14
92_L	97_H	0.529	0.14
41_M	82_T	0.529	0.14
11_A	52_V	0.528	0.14
27_T	58_K	0.524	0.14
2_K	88_E	0.521	0.14
50_A	79_E	0.520	0.14
13_L	55_H	0.515	0.13
54_Y	71_T	0.513	0.13
3_A	31_S	0.510	0.13
37_N	58_K	0.509	0.13
34_A	51_K	0.505	0.13
22_Y	54_Y	0.505	0.13
3_A	56_Q	0.501	0.13
87_D	92_L	0.500	0.13

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1njhA	2	0.9138	100	0.049	Contact Map
3k59A	1	0.3534	11.7	0.956	Contact Map
4raaA	1	0.9052	9.2	0.958	Contact Map
4l9bA	3	0.5948	8.7	0.959	Contact Map
2qg3A	2	0.9741	6.5	0.961	Contact Map
1jb7A	1	0.3534	5.9	0.962	Contact Map
3amjB	1	0.25	5.5	0.962	Contact Map
2eecA	1	0.5086	5.5	0.962	Contact Map
4yiiA	1	0.2759	5.4	0.963	Contact Map
2essA	2	0.6897	4.7	0.964	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0055 seconds.