YOJG - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YOJG - Uncharacterized deacetylase YojG

UniProt:	O31857	Sequences: MKEHVLVILPHPDDESYGVAGLIALNRKKDIPVTYACATLGEMGRNMGDPFFANRETLPLLRKQELINACKEMDINDLRMLGLRDKTLEFEDDEYLADIMEEIIDDVKPSLIVTFYPGHGVHPDHDACGEAVIRALYRKKKEDRPRTICMAITRNREEVLGEADVVLDIKEVADIKMNALRAHRTQTEGMLRELEEKLKNNEPVMATWFEEEIYWTYQWND	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	221 (187)
Sequences:	4633 (3271)
Seq/√Len:	239.2

ECOLI - YAIS
BACSU - YOJG YPJG
SULSO - Q97UU2

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
38_A	128_C	2.967	1.00
4_H	32_P	2.945	1.00
83_L	99_I	2.923	1.00
21_G	169_I	2.853	1.00
34_T	107_V	2.848	1.00
68_N	71_K	2.811	1.00
28_K	175_I	2.720	1.00
28_K	172_V	2.600	1.00
26_N	31_I	2.427	1.00
34_T	79_R	2.392	1.00
25_L	29_K	2.386	1.00
127_A	130_E	2.308	1.00
7_V	23_I	2.308	1.00
5_V	26_N	2.292	1.00
72_E	182_A	2.263	1.00
8_I	132_V	2.230	1.00
25_L	172_V	2.224	1.00
40_L	63_K	2.141	1.00
34_T	77_D	1.997	1.00
36_A	103_I	1.968	1.00
79_R	106_D	1.934	1.00
178_N	181_R	1.819	1.00
24_A	175_I	1.805	1.00
64_Q	68_N	1.797	1.00
114_T	132_V	1.765	1.00
112_I	136_L	1.763	1.00
6_L	104_I	1.721	1.00
6_L	36_A	1.696	1.00
79_R	103_I	1.691	1.00
68_N	182_A	1.681	1.00
96_L	131_A	1.649	1.00
37_C	66_L	1.623	1.00
32_P	77_D	1.575	1.00
72_E	178_N	1.570	1.00
27_R	33_V	1.559	1.00
4_H	110_S	1.555	1.00
16_S	69_A	1.535	1.00
26_N	113_V	1.528	1.00
8_I	36_A	1.503	1.00
97_A	134_R	1.488	1.00
99_I	102_E	1.459	1.00
7_V	15_E	1.448	1.00
23_I	27_R	1.441	1.00
40_L	82_G	1.412	1.00
23_I	33_V	1.410	1.00
72_E	175_I	1.402	1.00
177_M	181_R	1.388	1.00
101_E	138_R	1.376	1.00
63_K	67_I	1.366	1.00
126_D	130_E	1.357	1.00
10_P	115_F	1.350	1.00
21_G	176_K	1.338	1.00
7_V	113_V	1.322	1.00
79_R	107_V	1.314	1.00
4_H	34_T	1.308	1.00
148_I	151_A	1.280	1.00
68_N	184_R	1.273	1.00
112_I	132_V	1.270	1.00
155_N	158_E	1.265	1.00
54_N	57_T	1.236	1.00
63_K	82_G	1.233	1.00
19_V	113_V	1.229	1.00
24_A	73_M	1.210	1.00
24_A	28_K	1.209	1.00
175_I	178_N	1.203	1.00
28_K	171_E	1.197	1.00
103_I	106_D	1.195	1.00
104_I	112_I	1.189	1.00
103_I	107_V	1.182	1.00
101_E	105_D	1.171	1.00
22_L	26_N	1.166	1.00
25_L	167_L	1.165	1.00
64_Q	67_I	1.157	1.00
25_L	171_E	1.154	1.00
144_R	147_T	1.152	1.00
95_Y	99_I	1.115	1.00
36_A	100_M	1.115	1.00
23_I	73_M	1.102	1.00
105_D	139_K	1.101	1.00
73_M	179_A	1.095	1.00
174_D	178_N	1.090	1.00
67_I	71_K	1.075	1.00
173_A	177_M	1.075	1.00
24_A	179_A	1.064	1.00
63_K	80_M	1.063	1.00
38_A	81_L	1.057	1.00
93_D	97_A	1.043	1.00
20_A	73_M	1.043	1.00
65_E	186_Q	1.043	1.00
81_L	99_I	1.035	1.00
128_C	132_V	1.026	1.00
154_R	157_E	1.022	1.00
37_C	78_L	1.015	1.00
9_L	115_F	1.014	1.00
21_G	168_D	1.006	1.00
57_T	60_L	1.001	1.00
20_A	179_A	0.996	1.00
69_A	179_A	0.996	1.00
24_A	172_V	0.993	1.00
32_P	76_N	0.986	1.00
8_I	100_M	0.981	1.00
9_L	15_E	0.978	1.00
146_R	150_M	0.976	1.00
93_D	130_E	0.970	1.00
27_R	76_N	0.970	1.00
129_G	133_I	0.966	1.00
168_D	172_V	0.966	1.00
94_E	98_D	0.966	1.00
172_V	175_I	0.966	1.00
43_M	84_R	0.965	1.00
66_L	80_M	0.962	1.00
143_D	146_R	0.959	1.00
68_N	72_E	0.958	1.00
194_L	197_K	0.957	1.00
144_R	149_C	0.955	1.00
70_C	78_L	0.952	1.00
184_R	188_E	0.907	1.00
67_I	78_L	0.906	1.00
77_D	107_V	0.901	1.00
23_I	35_Y	0.892	1.00
15_E	35_Y	0.890	1.00
8_I	38_A	0.887	0.99
66_L	183_H	0.886	0.99
146_R	149_C	0.885	0.99
12_P	41_G	0.884	0.99
6_L	107_V	0.879	0.99
97_A	138_R	0.878	0.99
39_T	88_L	0.878	0.99
83_L	96_L	0.876	0.99
127_A	131_A	0.871	0.99
148_I	152_I	0.870	0.99
147_T	151_A	0.865	0.99
27_R	74_D	0.860	0.99
41_G	85_D	0.851	0.99
100_M	131_A	0.850	0.99
53_A	57_T	0.847	0.99
191_L	194_L	0.845	0.99
6_L	109_P	0.842	0.99
145_P	151_A	0.840	0.99
144_R	148_I	0.839	0.99
152_I	158_E	0.837	0.99
84_R	87_T	0.822	0.99
98_D	138_R	0.821	0.99
45_R	58_L	0.816	0.99
5_V	31_I	0.809	0.99
101_E	135_A	0.800	0.99
61_L	185_T	0.798	0.99
153_T	156_R	0.798	0.99
31_I	110_S	0.798	0.99
97_A	135_A	0.797	0.99
65_E	185_T	0.795	0.99
134_R	137_Y	0.788	0.99
35_Y	70_C	0.785	0.99
67_I	80_M	0.784	0.99
102_E	106_D	0.784	0.99
99_I	103_I	0.783	0.99
93_D	96_L	0.779	0.99
154_R	158_E	0.778	0.99
24_A	27_R	0.775	0.99
42_E	84_R	0.769	0.99
85_D	124_D	0.764	0.98
70_C	75_I	0.764	0.98
16_S	183_H	0.753	0.98
38_A	88_L	0.750	0.98
6_L	103_I	0.750	0.98
91_E	95_Y	0.750	0.98
40_L	59_P	0.736	0.98
93_D	134_R	0.736	0.98
152_I	156_R	0.736	0.98
169_I	172_V	0.733	0.98
13_D	122_H	0.728	0.98
147_T	150_M	0.728	0.98
37_C	80_M	0.728	0.98
42_E	59_P	0.727	0.98
93_D	127_A	0.725	0.98
43_M	86_K	0.724	0.98
51_F	54_N	0.717	0.98
16_S	66_L	0.712	0.98
97_A	101_E	0.710	0.98
152_I	157_E	0.706	0.97
5_V	113_V	0.697	0.97
98_D	102_E	0.693	0.97
169_I	173_A	0.688	0.97
91_E	96_L	0.685	0.97
104_I	136_L	0.681	0.97
100_M	132_V	0.677	0.97
144_R	150_M	0.674	0.97
193_E	197_K	0.674	0.97
145_P	149_C	0.673	0.97
35_Y	75_I	0.669	0.96
38_A	100_M	0.668	0.96
44_G	186_Q	0.665	0.96
69_A	182_A	0.663	0.96
149_C	152_I	0.660	0.96
22_L	167_L	0.655	0.96
36_A	81_L	0.654	0.96
31_I	113_V	0.652	0.96
62_R	85_D	0.652	0.96
190_M	193_E	0.648	0.96
104_I	135_A	0.647	0.96
52_F	55_R	0.645	0.96
192_R	195_E	0.645	0.96
40_L	80_M	0.645	0.96
4_H	31_I	0.643	0.96
5_V	111_L	0.643	0.96
114_T	129_G	0.642	0.96
60_L	64_Q	0.641	0.96
152_I	155_N	0.634	0.95
130_E	134_R	0.632	0.95
41_G	86_K	0.631	0.95
135_A	139_K	0.631	0.95
101_E	139_K	0.623	0.95
17_Y	20_A	0.622	0.95
36_A	107_V	0.618	0.95
44_G	86_K	0.616	0.94
88_L	128_C	0.616	0.94
43_M	87_T	0.610	0.94
88_L	96_L	0.607	0.94
160_L	163_A	0.606	0.94
13_D	125_H	0.605	0.94
44_G	85_D	0.604	0.94
105_D	141_K	0.602	0.94
20_A	27_R	0.600	0.94
191_L	195_E	0.597	0.94
12_P	183_H	0.595	0.93
94_E	138_R	0.594	0.93
41_G	62_R	0.593	0.93
8_I	128_C	0.589	0.93
94_E	134_R	0.589	0.93
9_L	19_V	0.589	0.93
16_S	20_A	0.589	0.93
15_E	66_L	0.588	0.93
84_R	88_L	0.588	0.93
66_L	70_C	0.587	0.93
14_D	125_H	0.582	0.93
83_L	88_L	0.582	0.93
117_P	129_G	0.581	0.93
146_R	153_T	0.580	0.93
56_E	60_L	0.578	0.92
88_L	127_A	0.577	0.92
20_A	176_K	0.576	0.92
119_H	126_D	0.574	0.92
150_M	154_R	0.574	0.92
139_K	142_E	0.572	0.92
115_F	120_G	0.563	0.91
22_L	113_V	0.562	0.91
193_E	196_E	0.560	0.91
149_C	155_N	0.559	0.91
145_P	148_I	0.554	0.91
189_G	192_R	0.554	0.91
143_D	149_C	0.554	0.91
159_V	162_E	0.552	0.91
81_L	103_I	0.552	0.91
93_D	131_A	0.552	0.91
136_L	140_K	0.549	0.90
94_E	97_A	0.544	0.90
21_G	172_V	0.542	0.90
13_D	62_R	0.540	0.90
148_I	155_N	0.536	0.89
174_D	177_M	0.534	0.89
62_R	186_Q	0.532	0.89
169_I	176_K	0.531	0.89
149_C	157_E	0.527	0.88
143_D	148_I	0.527	0.88
5_V	33_V	0.526	0.88
151_A	156_R	0.526	0.88
105_D	142_E	0.525	0.88
11_H	14_D	0.524	0.88
30_D	33_V	0.524	0.88
146_R	151_A	0.524	0.88
4_H	107_V	0.520	0.88
188_E	192_R	0.516	0.87
159_V	163_A	0.513	0.87
151_A	155_N	0.511	0.87
20_A	24_A	0.511	0.87
9_L	114_T	0.509	0.87
149_C	153_T	0.503	0.86
128_C	131_A	0.501	0.86
22_L	25_L	0.501	0.86
153_T	157_E	0.500	0.86

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4xlzA	5	0.9774	100	0.259	Contact Map
5bmoA	3	0.9502	100	0.265	Contact Map
2ixdA	5	0.914	100	0.267	Contact Map
1uanA	5	0.8914	100	0.276	Contact Map
1q74A	1	0.9683	100	0.283	Contact Map
3dffA	1	0.9548	100	0.299	Contact Map
3dfiA	1	0.9276	100	0.312	Contact Map
3ot5A	2	0.8371	93.3	0.896	Contact Map
4nesA	2	0.8371	87.7	0.909	Contact Map
4fkzA	2	0.8371	85.3	0.912	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.