YOJM - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YOJM - Superoxide dismutase-like protein YojM

UniProt:	O31851	Sequences: MHRLLLLMMLTALGVAGCGQKKPPDPPNRVPEKKVVETSAFGHHVQLVNREGKAVGFIEIKESDDEGLDIHISANSLRPGASLGFHIYEKGSCVRPDFESAGGPFNPLNKEHGFNNPMGHHAGDLPNLEVGADGKVDVIMNAPDTSLKKGSKLNILDEDGSAFIIHEQADDYLTNPSGNSGARIVCGALLGNNEKQ	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	196 (151)
Sequences:	1147 (866)
Seq/√Len:	70.5

ECOLI - SODC
BACSU - YOJM

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
58_I	72_I	3.162	1.00
131_G	135_K	2.963	1.00
174_T	177_S	2.875	1.00
91_G	188_A	2.770	1.00
167_E	182_A	2.575	1.00
73_S	137_D	2.470	1.00
78_R	184_I	2.413	1.00
155_I	161_S	2.412	1.00
60_I	163_F	2.349	1.00
58_I	163_F	2.278	1.00
72_I	138_V	2.239	1.00
61_K	71_H	2.157	1.00
67_G	141_N	2.155	1.00
45_V	187_G	2.088	1.00
69_D	139_I	2.071	1.00
125_L	142_A	2.069	1.00
80_G	130_V	1.854	1.00
130_V	136_V	1.843	1.00
81_A	129_E	1.839	1.00
101_A	162_A	1.839	1.00
47_L	74_A	1.838	1.00
93_C	186_C	1.760	1.00
87_I	189_L	1.755	1.00
81_A	169_A	1.706	1.00
47_L	185_V	1.687	1.00
171_D	178_G	1.616	0.99
84_G	180_S	1.558	0.99
87_I	145_T	1.548	0.99
105_F	154_N	1.545	0.99
77_L	136_V	1.540	0.99
173_L	176_P	1.539	0.99
86_H	104_P	1.527	0.99
72_I	85_F	1.516	0.99
125_L	145_T	1.500	0.99
49_N	55_V	1.500	0.99
83_L	130_V	1.489	0.99
174_T	180_S	1.389	0.98
112_H	121_H	1.383	0.98
94_V	100_S	1.378	0.98
172_Y	175_N	1.376	0.98
58_I	70_I	1.372	0.98
60_I	189_L	1.367	0.98
177_S	182_A	1.345	0.98
89_E	103_G	1.336	0.98
69_D	141_N	1.323	0.97
80_G	83_L	1.320	0.97
178_G	181_G	1.315	0.97
68_L	146_S	1.301	0.97
68_L	145_T	1.293	0.97
110_K	119_G	1.280	0.97
172_Y	176_P	1.280	0.97
120_H	142_A	1.275	0.97
72_I	139_I	1.266	0.97
170_D	178_G	1.242	0.96
105_F	122_A	1.233	0.96
171_D	174_T	1.216	0.96
57_F	73_S	1.194	0.95
72_I	136_V	1.175	0.95
92_S	100_S	1.166	0.95
107_P	121_H	1.163	0.95
107_P	122_A	1.154	0.94
56_G	74_A	1.150	0.94
95_R	99_E	1.144	0.94
121_H	181_G	1.135	0.94
106_N	110_K	1.130	0.94
68_L	147_L	1.109	0.93
127_N	171_D	1.108	0.93
84_G	128_L	1.100	0.93
104_P	166_H	1.097	0.93
90_K	162_A	1.092	0.93
77_L	165_I	1.088	0.92
86_H	166_H	1.087	0.92
74_A	136_V	1.078	0.92
43_H	187_G	1.060	0.91
45_V	91_G	1.059	0.91
130_V	133_D	1.058	0.91
98_F	161_S	1.051	0.91
168_Q	179_N	1.046	0.91
85_F	128_L	1.025	0.90
74_A	165_I	0.999	0.89
60_I	155_I	0.985	0.88
55_V	76_S	0.982	0.88
43_H	91_G	0.971	0.87
111_E	119_G	0.950	0.86
70_I	140_M	0.931	0.85
63_S	69_D	0.929	0.85
46_Q	54_A	0.927	0.85
114_F	172_Y	0.922	0.85
91_G	162_A	0.917	0.84
79_P	130_V	0.914	0.84
127_N	174_T	0.911	0.84
171_D	180_S	0.903	0.83
147_L	154_N	0.899	0.83
85_F	136_V	0.897	0.83
130_V	135_K	0.894	0.83
43_H	47_L	0.887	0.82
172_Y	177_S	0.883	0.82
78_R	83_L	0.882	0.82
49_N	53_K	0.877	0.81
111_E	175_N	0.868	0.81
121_H	170_D	0.866	0.81
113_G	117_P	0.861	0.80
128_L	136_V	0.857	0.80
156_L	161_S	0.856	0.80
62_E	68_L	0.855	0.80
177_S	180_S	0.854	0.80
93_C	176_P	0.853	0.80
60_I	70_I	0.850	0.79
62_E	66_E	0.850	0.79
121_H	177_S	0.840	0.79
42_G	59_E	0.834	0.78
65_D	141_N	0.833	0.78
106_N	122_A	0.825	0.77
71_H	139_I	0.824	0.77
47_L	52_G	0.820	0.77
105_F	161_S	0.812	0.76
120_H	144_D	0.811	0.76
106_N	112_H	0.809	0.76
104_P	181_G	0.805	0.76
174_T	178_G	0.802	0.75
108_L	153_L	0.796	0.75
90_K	161_S	0.792	0.74
98_F	164_I	0.788	0.74
142_A	145_T	0.785	0.74
103_G	166_H	0.785	0.74
71_H	75_N	0.784	0.74
113_G	116_N	0.783	0.74
126_P	172_Y	0.783	0.74
68_L	189_L	0.783	0.74
175_N	189_L	0.777	0.73
170_D	181_G	0.769	0.72
75_N	135_K	0.764	0.72
47_L	187_G	0.739	0.69
106_N	121_H	0.736	0.69
149_K	154_N	0.735	0.69
148_K	154_N	0.733	0.69
75_N	132_A	0.730	0.68
93_C	98_F	0.728	0.68
163_F	189_L	0.723	0.68
146_S	149_K	0.722	0.67
154_N	161_S	0.705	0.66
97_D	100_S	0.698	0.65
166_H	183_R	0.694	0.64
104_P	121_H	0.684	0.63
62_E	147_L	0.678	0.63
164_I	171_D	0.674	0.62
43_H	49_N	0.673	0.62
106_N	109_N	0.670	0.62
78_R	129_E	0.669	0.62
84_G	125_L	0.668	0.61
93_C	101_A	0.666	0.61
62_E	67_G	0.665	0.61
87_I	142_A	0.663	0.61
98_F	119_G	0.661	0.61
125_L	128_L	0.660	0.60
79_P	132_A	0.659	0.60
92_S	98_F	0.656	0.60
79_P	134_G	0.654	0.60
63_S	67_G	0.653	0.60
164_I	177_S	0.649	0.59
98_F	175_N	0.648	0.59
34_K	37_E	0.647	0.59
112_H	178_G	0.640	0.58
63_S	141_N	0.636	0.58
98_F	186_C	0.634	0.57
168_Q	184_I	0.631	0.57
112_H	171_D	0.630	0.57
60_I	68_L	0.627	0.57
87_I	105_F	0.627	0.57
85_F	165_I	0.626	0.56
142_A	174_T	0.626	0.56
95_R	98_F	0.625	0.56
85_F	145_T	0.609	0.54
113_G	171_D	0.609	0.54
111_E	118_M	0.605	0.54
53_K	132_A	0.604	0.54
86_H	183_R	0.600	0.53
171_D	177_S	0.599	0.53
113_G	120_H	0.593	0.52
118_M	152_K	0.591	0.52
63_S	117_P	0.590	0.52
108_L	167_E	0.589	0.52
105_F	145_T	0.588	0.52
112_H	127_N	0.584	0.51
93_C	172_Y	0.584	0.51
33_K	36_V	0.579	0.51
121_H	178_G	0.577	0.51
88_Y	166_H	0.576	0.50
47_L	58_I	0.575	0.50
35_V	73_S	0.574	0.50
53_K	117_P	0.574	0.50
43_H	190_L	0.573	0.50
164_I	174_T	0.570	0.50
60_I	87_I	0.569	0.50
45_V	142_A	0.565	0.49
163_F	187_G	0.562	0.49
44_H	50_R	0.559	0.48
45_V	49_N	0.559	0.48
71_H	137_D	0.558	0.48
88_Y	104_P	0.556	0.48
169_A	174_T	0.553	0.48
137_D	167_E	0.549	0.47
48_V	54_A	0.543	0.46
81_A	115_N	0.542	0.46
98_F	176_P	0.542	0.46
80_G	129_E	0.542	0.46
34_K	38_T	0.539	0.46
175_N	180_S	0.536	0.46
56_G	62_E	0.532	0.45
171_D	181_G	0.531	0.45
147_L	160_G	0.529	0.45
67_G	143_P	0.529	0.45
43_H	74_A	0.528	0.45
100_S	164_I	0.524	0.44
156_L	160_G	0.523	0.44
66_E	145_T	0.523	0.44
112_H	181_G	0.523	0.44
56_G	190_L	0.516	0.43
51_E	184_I	0.514	0.43
93_C	162_A	0.510	0.42
113_G	119_G	0.510	0.42
77_L	184_I	0.508	0.42
49_N	98_F	0.507	0.42
105_F	153_L	0.501	0.41
99_E	164_I	0.501	0.41
33_K	44_H	0.500	0.41

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1xtmB	2	0.7806	100	0.231	Contact Map
1to4A	2	0.7602	100	0.278	Contact Map
3f7lA	2	0.7398	100	0.278	Contact Map
2q2lA	1	0.7449	100	0.279	Contact Map
3pu7A	2	0.7551	100	0.28	Contact Map
3ce1A	2	0.7296	100	0.281	Contact Map
1xsoA	2	0.7347	100	0.281	Contact Map
1f1gA	3	0.7398	100	0.282	Contact Map
2e47A	2	0.7602	100	0.282	Contact Map
3l9yA	2	0.7449	100	0.285	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0083 seconds.