YOZC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YOZC - Uncharacterized protein YozC

UniProt:	O31848	Sequences: MIHKNWLEKETIKKVKCVQTNAKKYIVNRVLTPGKEYEVKNETEEFLFVVDNTNKVGGYYKEYFEEM	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	67 (65)
Sequences:	125 (75)
Seq/√Len:	9.3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
16_K	65_E	4.273	0.99
14_K	38_E	3.125	0.93
30_V	53_T	2.861	0.89
13_K	39_V	2.785	0.88
23_K	62_E	2.385	0.78
50_V	56_V	2.159	0.70
20_T	33_P	2.034	0.65
30_V	59_Y	1.662	0.49
11_T	40_K	1.654	0.49
17_C	40_K	1.595	0.46
20_T	60_Y	1.543	0.44
17_C	46_F	1.474	0.41
5_N	18_V	1.450	0.40
7_L	55_K	1.428	0.39
25_Y	56_V	1.372	0.37
54_N	60_Y	1.328	0.35
15_V	47_L	1.295	0.34
26_I	29_R	1.291	0.34
26_I	49_V	1.237	0.32
36_E	49_V	1.181	0.29
7_L	56_V	1.145	0.28
43_T	56_V	1.129	0.28
16_K	57_G	1.122	0.27
39_V	65_E	1.100	0.27
40_K	46_F	1.054	0.25
49_V	56_V	1.047	0.25
13_K	49_V	1.044	0.25
46_F	53_T	1.035	0.24
39_V	44_E	1.029	0.24
15_V	25_Y	1.022	0.24
21_N	26_I	1.000	0.23
54_N	57_G	0.999	0.23
43_T	52_N	0.997	0.23
12_I	57_G	0.993	0.23
4_K	33_P	0.977	0.23
14_K	36_E	0.953	0.22
4_K	26_I	0.952	0.22
4_K	29_R	0.916	0.21
8_E	50_V	0.904	0.20
3_H	18_V	0.873	0.19
11_T	46_F	0.862	0.19
6_W	61_K	0.858	0.19
21_N	25_Y	0.854	0.19
23_K	54_N	0.841	0.19
15_V	32_T	0.840	0.19
20_T	38_E	0.840	0.19
19_Q	23_K	0.827	0.18
3_H	11_T	0.827	0.18
26_I	59_Y	0.809	0.18
15_V	60_Y	0.808	0.18
4_K	38_E	0.808	0.18
35_K	57_G	0.803	0.18
17_C	29_R	0.802	0.18
5_N	47_L	0.789	0.17
11_T	17_C	0.789	0.17
8_E	52_N	0.788	0.17
2_I	40_K	0.780	0.17
44_E	50_V	0.779	0.17
33_P	55_K	0.745	0.16
4_K	47_L	0.743	0.16
5_N	9_K	0.741	0.16
28_N	44_E	0.736	0.16
7_L	10_E	0.722	0.16
9_K	21_N	0.713	0.15
35_K	50_V	0.706	0.15
9_K	47_L	0.687	0.15
23_K	35_K	0.677	0.15
9_K	50_V	0.675	0.15
12_I	16_K	0.675	0.15
36_E	65_E	0.664	0.14
33_P	60_Y	0.659	0.14
1_M	61_K	0.656	0.14
26_I	53_T	0.650	0.14
9_K	26_I	0.646	0.14
42_E	61_K	0.623	0.13
12_I	18_V	0.622	0.13
15_V	20_T	0.622	0.13
52_N	60_Y	0.619	0.13
10_E	30_V	0.616	0.13
5_N	15_V	0.610	0.13
3_H	23_K	0.609	0.13
13_K	62_E	0.600	0.13
13_K	38_E	0.596	0.13
43_T	53_T	0.592	0.13
29_R	53_T	0.580	0.13
1_M	6_W	0.577	0.13
12_I	23_K	0.572	0.12
8_E	15_V	0.566	0.12
15_V	56_V	0.563	0.12
8_E	12_I	0.560	0.12
2_I	5_N	0.558	0.12
17_C	48_F	0.552	0.12
25_Y	62_E	0.549	0.12
5_N	14_K	0.534	0.12
11_T	49_V	0.533	0.12
8_E	36_E	0.512	0.11
18_V	53_T	0.510	0.11
5_N	54_N	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4nehB	1	0.791	19.6	0.919	Contact Map
4igiA	1	0.3134	19.4	0.919	Contact Map
4okrA	1	0.4328	19	0.919	Contact Map
2odpA	1	0.4478	17	0.921	Contact Map
1atzA	1	0.3881	14.2	0.924	Contact Map
4z9nA	2	0.7164	13.6	0.924	Contact Map
1mf7A	1	0.4328	12.5	0.925	Contact Map
1mjnA	1	0.3433	12.4	0.926	Contact Map
1pt6A	1	0.2985	11.4	0.927	Contact Map
1rrkA	1	0.3731	11	0.927	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0051 seconds.