YOZO - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YOZO - Uncharacterized protein YozO

UniProt:	O31847	Sequences: MGIFSVSRSTDAKKLEALLVEGERIESIYKLRVDQICFTNKRIIFFDNKMFSKKKVRVFLPYKTIESFAIQEAGMFDPDTGLLLMTRSKTFELEFAKDTDLSEVQAVLTKHLCS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	114 (104)
Sequences:	576 (378)
Seq/√Len:	37.1

BACSU - YOZO YJQA

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
21_E	110_K	2.974	1.00
59_F	112_L	2.674	1.00
33_V	49_K	2.552	1.00
66_E	87_R	2.519	1.00
60_L	91_F	2.455	1.00
83_L	92_E	2.398	1.00
35_Q	46_F	2.350	1.00
70_I	82_L	2.291	0.99
38_F	62_Y	2.266	0.99
33_V	50_M	2.238	0.99
96_A	99_T	2.196	0.99
54_K	84_L	2.095	0.99
15_L	18_L	2.056	0.99
21_E	106_A	2.013	0.99
105_Q	109_T	1.983	0.98
70_I	105_Q	1.905	0.98
45_F	93_L	1.888	0.98
57_R	69_A	1.807	0.97
67_S	89_K	1.780	0.97
36_I	45_F	1.752	0.97
36_I	93_L	1.723	0.96
49_K	53_K	1.654	0.95
14_K	48_N	1.592	0.94
43_I	93_L	1.573	0.94
15_L	37_C	1.477	0.91
50_M	53_K	1.425	0.90
24_R	40_N	1.419	0.90
17_A	100_D	1.399	0.89
55_K	71_Q	1.324	0.86
16_E	100_D	1.243	0.82
47_D	57_R	1.235	0.82
21_E	40_N	1.210	0.81
33_V	52_S	1.209	0.81
98_D	103_E	1.197	0.80
16_E	25_I	1.144	0.77
26_E	40_N	1.139	0.77
57_R	83_L	1.131	0.76
33_V	53_K	1.129	0.76
55_K	77_D	1.115	0.75
14_K	43_I	1.105	0.74
11_D	104_V	1.094	0.74
43_I	65_I	1.092	0.73
20_V	109_T	1.089	0.73
48_N	56_V	1.063	0.71
26_E	111_H	1.050	0.70
15_L	107_V	1.035	0.69
52_S	75_M	1.034	0.69
31_L	108_L	1.030	0.69
79_D	94_E	1.029	0.69
105_Q	108_L	0.998	0.66
73_A	97_K	0.996	0.66
59_F	71_Q	0.994	0.66
75_M	78_P	0.989	0.66
38_F	59_F	0.988	0.66
80_T	83_L	0.980	0.65
54_K	72_E	0.976	0.65
61_P	77_D	0.970	0.64
31_L	36_I	0.966	0.64
30_K	37_C	0.947	0.62
51_F	76_F	0.941	0.62
21_E	80_T	0.933	0.61
82_L	101_L	0.915	0.60
95_F	103_E	0.914	0.60
36_I	41_K	0.910	0.59
86_T	105_Q	0.907	0.59
60_L	86_T	0.906	0.59
11_D	16_E	0.889	0.57
36_I	67_S	0.880	0.57
35_Q	48_N	0.875	0.56
57_R	91_F	0.873	0.56
68_F	109_T	0.868	0.56
28_I	61_P	0.863	0.55
45_F	60_L	0.853	0.54
9_S	54_K	0.842	0.53
25_I	28_I	0.815	0.51
11_D	24_R	0.811	0.51
73_A	102_S	0.809	0.50
29_Y	103_E	0.805	0.50
107_V	111_H	0.805	0.50
22_G	110_K	0.805	0.50
17_A	102_S	0.798	0.49
29_Y	95_F	0.796	0.49
85_M	109_T	0.787	0.48
35_Q	75_M	0.785	0.48
68_F	77_D	0.777	0.48
10_T	29_Y	0.776	0.47
94_E	99_T	0.769	0.47
64_T	109_T	0.768	0.47
54_K	75_M	0.751	0.45
13_K	97_K	0.741	0.44
28_I	37_C	0.740	0.44
102_S	105_Q	0.740	0.44
95_F	104_V	0.739	0.44
31_L	112_L	0.731	0.44
100_D	103_E	0.728	0.43
50_M	81_G	0.727	0.43
104_V	111_H	0.726	0.43
42_R	59_F	0.718	0.42
29_Y	48_N	0.713	0.42
83_L	90_T	0.706	0.41
89_K	111_H	0.684	0.40
30_K	63_K	0.683	0.39
48_N	79_D	0.681	0.39
58_V	75_M	0.679	0.39
60_L	73_A	0.678	0.39
43_I	109_T	0.677	0.39
81_G	104_V	0.675	0.39
82_L	95_F	0.672	0.39
37_C	41_K	0.660	0.38
37_C	94_E	0.652	0.37
33_V	81_G	0.651	0.37
62_Y	68_F	0.651	0.37
70_I	102_S	0.648	0.37
38_F	82_L	0.645	0.36
47_D	93_L	0.644	0.36
82_L	93_L	0.635	0.35
27_S	103_E	0.631	0.35
17_A	106_A	0.627	0.35
53_K	72_E	0.624	0.35
69_A	85_M	0.624	0.35
68_F	85_M	0.623	0.35
76_F	87_R	0.615	0.34
37_C	103_E	0.614	0.34
35_Q	99_T	0.611	0.34
86_T	95_F	0.591	0.32
96_A	107_V	0.582	0.31
60_L	67_S	0.580	0.31
93_L	97_K	0.573	0.31
31_L	94_E	0.570	0.30
72_E	95_F	0.569	0.30
12_A	98_D	0.565	0.30
27_S	70_I	0.563	0.30
40_N	89_K	0.558	0.30
76_F	95_F	0.556	0.29
99_T	111_H	0.554	0.29
72_E	105_Q	0.554	0.29
18_L	95_F	0.543	0.28
64_T	86_T	0.543	0.28
15_L	81_G	0.539	0.28
40_N	101_L	0.537	0.28
62_Y	77_D	0.534	0.28
12_A	107_V	0.533	0.28
49_K	55_K	0.532	0.28
20_V	69_A	0.532	0.28
28_I	36_I	0.528	0.27
95_F	101_L	0.515	0.26
20_V	56_V	0.513	0.26
71_Q	81_G	0.512	0.26
27_S	107_V	0.510	0.26
13_K	24_R	0.510	0.26
64_T	67_S	0.509	0.26
19_L	25_I	0.506	0.26
65_I	105_Q	0.506	0.26
27_S	73_A	0.505	0.26
95_F	102_S	0.502	0.26
68_F	72_E	0.500	0.25

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3hsaA	3	0.9123	100	0.179	Contact Map
3b77A	4	0.9737	100	0.343	Contact Map
2cayA	4	0.9474	96.5	0.863	Contact Map
2hthB	1	0.8684	94.7	0.88	Contact Map
1zsqA	1	0.8509	89.4	0.898	Contact Map
1lw3A	1	0.8421	87.2	0.902	Contact Map
1w7pD	1	0	71.5	0.916	Contact Map
1zyiA	1	0.7105	66.6	0.919	Contact Map
4f7uQ	1	0.8684	62.7	0.921	Contact Map
4k17A	1	0.8684	55.6	0.924	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0052 seconds.