YOZK - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YOZK - DNA repair protein homolog YozK

UniProt:	O31841	Sequences: MTDYSQFPRENILCVDMKSFYASVSAVAMGLNPLTCYLAVVGNTDRQGSVVLAASPALKKDFGIKTGSRLFEIPEDPRIYIVNPQMKLFIRVSTEITKLFYRFVPEKCVHTYSID	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	115 (107)
Sequences:	793 (398)
Seq/√Len:	38.5

BACSU - YOZK

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
28_A	88_L	4.738	1.00
92_V	95_E	4.535	1.00
105_P	108_C	3.954	1.00
26_A	36_C	3.361	1.00
87_K	91_R	3.204	1.00
28_A	92_V	3.093	1.00
47_Q	74_P	3.063	1.00
29_M	82_V	2.750	1.00
104_V	109_V	2.302	1.00
90_I	114_I	1.877	0.98
95_E	98_K	1.848	0.98
94_T	98_K	1.721	0.97
62_F	68_S	1.686	0.96
54_A	64_I	1.630	0.95
28_A	85_Q	1.588	0.95
64_I	68_S	1.528	0.93
88_L	92_V	1.439	0.91
21_Y	55_S	1.430	0.91
25_S	85_Q	1.407	0.90
101_Y	106_E	1.392	0.90
88_L	91_R	1.373	0.89
42_G	50_V	1.355	0.88
84_P	90_I	1.346	0.88
24_V	28_A	1.331	0.88
98_K	101_Y	1.327	0.87
57_A	61_D	1.317	0.87
73_I	76_D	1.265	0.85
35_T	57_A	1.258	0.84
28_A	91_R	1.254	0.84
29_M	91_R	1.242	0.84
31_L	80_Y	1.211	0.82
54_A	58_L	1.202	0.82
71_F	87_K	1.187	0.81
43_N	81_I	1.186	0.81
25_S	89_F	1.159	0.79
96_I	99_L	1.158	0.79
38_L	82_V	1.146	0.78
37_Y	57_A	1.142	0.78
103_F	110_H	1.132	0.77
32_N	35_T	1.104	0.76
66_T	74_P	1.093	0.75
97_T	109_V	1.090	0.75
24_V	88_L	1.089	0.75
74_P	79_I	1.076	0.74
18_K	34_L	1.074	0.74
41_V	50_V	1.071	0.73
54_A	66_T	1.029	0.70
15_V	100_F	1.026	0.70
93_S	97_T	1.019	0.70
21_Y	90_I	1.019	0.70
11_N	90_I	1.015	0.69
44_T	83_N	1.011	0.69
13_L	90_I	1.002	0.68
85_Q	88_L	0.996	0.68
12_I	37_Y	0.990	0.67
61_D	78_R	0.989	0.67
65_K	73_I	0.983	0.67
70_L	81_I	0.975	0.66
54_A	72_E	0.963	0.65
41_V	70_L	0.957	0.65
39_A	73_I	0.939	0.63
58_L	79_I	0.922	0.62
37_Y	62_F	0.906	0.60
42_G	93_S	0.900	0.60
91_R	95_E	0.889	0.59
33_P	38_L	0.869	0.57
26_A	38_L	0.855	0.56
43_N	46_R	0.835	0.54
54_A	68_S	0.831	0.54
51_V	79_I	0.822	0.53
64_I	77_P	0.819	0.53
46_R	49_S	0.815	0.52
21_Y	85_Q	0.810	0.52
42_G	49_S	0.804	0.51
11_N	27_V	0.803	0.51
51_V	77_P	0.789	0.50
29_M	83_N	0.786	0.50
17_M	100_F	0.785	0.50
70_L	73_I	0.784	0.50
68_S	74_P	0.770	0.48
51_V	73_I	0.768	0.48
41_V	49_S	0.762	0.48
72_E	81_I	0.759	0.47
11_N	24_V	0.754	0.47
112_Y	115_D	0.754	0.47
51_V	54_A	0.746	0.46
62_F	78_R	0.740	0.46
29_M	38_L	0.739	0.46
37_Y	77_P	0.739	0.46
28_A	95_E	0.723	0.44
21_Y	49_S	0.720	0.44
71_F	85_Q	0.712	0.43
100_F	111_T	0.706	0.43
46_R	66_T	0.694	0.42
13_L	64_I	0.692	0.41
14_C	71_F	0.685	0.41
13_L	94_T	0.681	0.40
20_F	104_V	0.679	0.40
37_Y	78_R	0.675	0.40
88_L	100_F	0.674	0.40
54_A	65_K	0.673	0.40
63_G	89_F	0.671	0.40
10_E	84_P	0.671	0.40
27_V	99_L	0.670	0.39
58_L	66_T	0.666	0.39
42_G	45_D	0.665	0.39
10_E	13_L	0.665	0.39
41_V	45_D	0.659	0.39
11_N	43_N	0.658	0.38
104_V	108_C	0.645	0.37
91_R	96_I	0.645	0.37
37_Y	61_D	0.638	0.37
99_L	106_E	0.638	0.37
43_N	47_Q	0.631	0.36
91_R	98_K	0.630	0.36
15_V	20_F	0.625	0.36
62_F	76_D	0.621	0.35
58_L	67_G	0.618	0.35
49_S	93_S	0.612	0.35
14_C	73_I	0.608	0.34
48_G	71_F	0.607	0.34
39_A	54_A	0.607	0.34
50_V	67_G	0.606	0.34
78_R	102_R	0.604	0.34
11_N	14_C	0.604	0.34
51_V	68_S	0.603	0.34
69_R	72_E	0.603	0.34
42_G	97_T	0.595	0.33
48_G	70_L	0.588	0.33
58_L	106_E	0.583	0.32
39_A	81_I	0.578	0.32
26_A	62_F	0.576	0.32
24_V	91_R	0.576	0.32
44_T	70_L	0.575	0.32
12_I	51_V	0.568	0.31
28_A	63_G	0.566	0.31
101_Y	109_V	0.563	0.31
69_R	103_F	0.561	0.31
96_I	103_F	0.560	0.31
33_P	40_V	0.557	0.30
14_C	66_T	0.557	0.30
21_Y	109_V	0.557	0.30
39_A	64_I	0.551	0.30
33_P	69_R	0.544	0.29
31_L	35_T	0.542	0.29
29_M	80_Y	0.540	0.29
99_L	109_V	0.538	0.29
50_V	65_K	0.537	0.29
14_C	48_G	0.535	0.29
91_R	102_R	0.529	0.28
54_A	67_G	0.528	0.28
25_S	82_V	0.523	0.28
30_G	95_E	0.522	0.28
25_S	29_M	0.515	0.27
9_R	114_I	0.515	0.27
14_C	37_Y	0.514	0.27
36_C	80_Y	0.511	0.27
8_P	75_E	0.507	0.27
20_F	24_V	0.506	0.27
39_A	58_L	0.500	0.26

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2aq4A	1	0.9739	99.9	0.542	Contact Map
3osnA	1	0.8696	99.9	0.545	Contact Map
4f50A	1	0.8609	99.9	0.553	Contact Map
4q45F	1	0.8957	99.9	0.553	Contact Map
4tqrA	1	0.887	99.9	0.565	Contact Map
4dezA	2	0.8609	99.9	0.566	Contact Map
3pzpA	1	0.9217	99.9	0.567	Contact Map
4ecqA	1	0.9391	99.9	0.569	Contact Map
1t94A	1	0.9217	99.9	0.57	Contact Map
3mfiA	1	0.9217	99.9	0.592	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0056 seconds.