YOAS - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YOAS - Uncharacterized membrane protein YoaS

UniProt:	O31833	Sequences: MNRMSTIFLKIALVLIGIPILALCIFLVPKVANYSAELFPNIAYIKYLVFIYLYVTAIPFYFALYQAFKLLSYIDKNKAFSGLSVRALKNIKYCAVTISIFYAAGMPVFYLMAEIDDAPGIIVIGLVIIFASMVIAVFAAVLQKLLKEAIDIKSENDLTV	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	160 (158)
Sequences:	376 (285)
Seq/√Len:	22.6

BACSU - YOAS

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
53_L	56_T	3.413	1.00
144_K	148_E	3.176	1.00
113_A	118_A	3.083	1.00
110_Y	122_I	2.947	0.99
5_S	148_E	2.821	0.99
114_E	122_I	2.658	0.99
144_K	147_K	2.485	0.98
107_P	118_A	2.386	0.98
73_Y	84_S	2.288	0.97
31_V	39_F	2.157	0.96
48_L	52_Y	2.136	0.95
147_K	151_D	2.110	0.95
107_P	113_A	2.105	0.95
16_I	60_F	2.079	0.95
109_F	128_I	2.055	0.94
112_M	121_I	2.010	0.93
119_P	123_V	1.984	0.93
53_L	102_Y	1.970	0.93
6_T	141_V	1.966	0.93
56_T	102_Y	1.950	0.92
52_Y	105_G	1.929	0.92
27_L	46_K	1.916	0.92
57_A	139_A	1.914	0.92
4_M	148_E	1.903	0.91
39_F	42_I	1.749	0.87
110_Y	118_A	1.745	0.87
46_K	105_G	1.725	0.87
78_K	147_K	1.715	0.86
29_P	32_A	1.699	0.86
155_E	160_V	1.660	0.85
116_D	120_G	1.619	0.83
58_I	106_M	1.573	0.81
100_I	104_A	1.569	0.81
12_A	16_I	1.525	0.79
48_L	109_F	1.525	0.79
58_I	72_S	1.507	0.78
114_E	118_A	1.504	0.78
124_I	133_M	1.472	0.76
60_F	102_Y	1.471	0.76
54_Y	157_D	1.434	0.75
88_L	95_A	1.432	0.74
106_M	113_A	1.397	0.73
82_G	93_Y	1.372	0.71
96_V	100_I	1.371	0.71
40_P	48_L	1.342	0.69
10_K	92_K	1.336	0.69
34_Y	105_G	1.300	0.67
86_R	90_N	1.292	0.66
15_L	77_N	1.291	0.66
6_T	75_D	1.284	0.66
14_V	62_F	1.269	0.65
116_D	141_V	1.224	0.62
92_K	143_Q	1.223	0.62
6_T	152_I	1.221	0.62
56_T	128_I	1.189	0.60
5_S	144_K	1.177	0.59
31_V	105_G	1.174	0.59
14_V	127_V	1.156	0.58
19_P	107_P	1.152	0.57
107_P	119_P	1.142	0.57
97_T	147_K	1.139	0.56
27_L	56_T	1.133	0.56
107_P	110_Y	1.111	0.55
126_L	150_I	1.103	0.54
146_L	150_I	1.071	0.52
23_L	110_Y	1.057	0.51
99_S	154_S	1.053	0.51
57_A	61_Y	1.052	0.50
134_V	138_F	1.043	0.50
115_I	122_I	1.032	0.49
58_I	157_D	1.028	0.49
117_D	120_G	1.020	0.48
73_Y	83_L	1.017	0.48
15_L	151_D	1.015	0.48
68_F	101_F	1.010	0.48
22_A	89_K	1.004	0.47
14_V	18_I	1.004	0.47
57_A	137_V	1.002	0.47
18_I	51_I	0.984	0.46
29_P	35_S	0.976	0.45
48_L	108_V	0.973	0.45
72_S	126_L	0.971	0.45
27_L	44_Y	0.967	0.45
19_P	22_A	0.965	0.45
49_V	69_K	0.960	0.44
53_L	128_I	0.956	0.44
109_F	123_V	0.949	0.43
35_S	105_G	0.948	0.43
34_Y	112_M	0.948	0.43
38_L	121_I	0.945	0.43
28_V	66_Q	0.942	0.43
28_V	48_L	0.930	0.42
12_A	19_P	0.927	0.42
114_E	117_D	0.927	0.42
19_P	60_F	0.920	0.41
95_A	142_L	0.911	0.41
124_I	129_I	0.907	0.41
68_F	157_D	0.907	0.41
151_D	157_D	0.895	0.40
102_Y	129_I	0.882	0.39
4_M	152_I	0.875	0.38
123_V	126_L	0.874	0.38
23_L	108_V	0.874	0.38
9_L	74_I	0.866	0.38
42_I	127_V	0.862	0.38
73_Y	96_V	0.858	0.37
31_V	112_M	0.834	0.36
61_Y	68_F	0.829	0.36
66_Q	98_I	0.829	0.36
72_S	78_K	0.828	0.35
83_L	147_K	0.821	0.35
100_I	123_V	0.816	0.35
122_I	129_I	0.816	0.35
123_V	128_I	0.815	0.35
112_M	133_M	0.813	0.35
17_G	64_L	0.812	0.34
5_S	45_I	0.810	0.34
82_G	141_V	0.810	0.34
17_G	60_F	0.808	0.34
75_D	138_F	0.801	0.34
53_L	121_I	0.797	0.34
31_V	46_K	0.795	0.33
128_I	135_I	0.795	0.33
102_Y	128_I	0.794	0.33
110_Y	124_I	0.792	0.33
118_A	122_I	0.788	0.33
49_V	101_F	0.781	0.33
124_I	128_I	0.778	0.32
86_R	126_L	0.775	0.32
14_V	104_A	0.765	0.32
50_F	105_G	0.763	0.31
102_Y	119_P	0.762	0.31
123_V	129_I	0.760	0.31
35_S	52_Y	0.760	0.31
32_A	86_R	0.758	0.31
39_F	48_L	0.757	0.31
35_S	49_V	0.755	0.31
46_K	160_V	0.752	0.31
13_L	64_L	0.752	0.31
12_A	20_I	0.748	0.31
8_F	92_K	0.743	0.30
35_S	39_F	0.741	0.30
28_V	50_F	0.741	0.30
146_L	159_T	0.738	0.30
42_I	49_V	0.734	0.30
7_I	152_I	0.728	0.29
59_P	62_F	0.727	0.29
75_D	107_P	0.721	0.29
14_V	77_N	0.719	0.29
107_P	114_E	0.714	0.29
36_A	110_Y	0.707	0.28
108_V	129_I	0.702	0.28
85_V	92_K	0.702	0.28
21_L	29_P	0.699	0.28
36_A	49_V	0.699	0.28
126_L	160_V	0.696	0.28
51_I	90_N	0.695	0.28
53_L	136_A	0.679	0.27
95_A	129_I	0.679	0.27
91_I	95_A	0.678	0.27
85_V	150_I	0.677	0.27
114_E	125_G	0.677	0.27
27_L	62_F	0.670	0.26
39_F	105_G	0.667	0.26
8_F	146_L	0.666	0.26
80_F	159_T	0.663	0.26
65_Y	90_N	0.662	0.26
130_F	134_V	0.661	0.26
109_F	121_I	0.660	0.26
88_L	142_L	0.652	0.25
17_G	94_C	0.647	0.25
24_C	142_L	0.642	0.25
11_I	82_G	0.642	0.25
34_Y	39_F	0.639	0.25
65_Y	96_V	0.638	0.25
10_K	68_F	0.637	0.24
155_E	159_T	0.636	0.24
91_I	135_I	0.635	0.24
40_P	105_G	0.634	0.24
48_L	55_V	0.631	0.24
110_Y	114_E	0.629	0.24
69_K	116_D	0.623	0.24
31_V	35_S	0.622	0.24
27_L	35_S	0.621	0.24
92_K	146_L	0.620	0.24
65_Y	73_Y	0.615	0.23
30_K	52_Y	0.611	0.23
111_L	133_M	0.609	0.23
44_Y	105_G	0.605	0.23
10_K	89_K	0.601	0.23
72_S	76_K	0.599	0.23
42_I	135_I	0.593	0.22
70_L	135_I	0.592	0.22
11_I	62_F	0.588	0.22
99_S	132_S	0.588	0.22
82_G	86_R	0.583	0.22
149_A	159_T	0.581	0.22
69_K	148_E	0.579	0.22
36_A	40_P	0.575	0.21
3_R	16_I	0.572	0.21
60_F	67_A	0.570	0.21
48_L	61_Y	0.565	0.21
34_Y	48_L	0.564	0.21
28_V	57_A	0.563	0.21
42_I	48_L	0.558	0.21
38_L	159_T	0.558	0.21
24_C	57_A	0.557	0.21
45_I	139_A	0.557	0.21
87_A	132_S	0.556	0.21
34_Y	38_L	0.555	0.21
52_Y	111_L	0.551	0.20
63_A	132_S	0.551	0.20
72_S	127_V	0.549	0.20
85_V	116_D	0.547	0.20
70_L	84_S	0.543	0.20
86_R	147_K	0.542	0.20
7_I	93_Y	0.542	0.20
91_I	139_A	0.536	0.20
113_A	119_P	0.534	0.20
3_R	148_E	0.533	0.20
52_Y	109_F	0.530	0.19
76_K	133_M	0.528	0.19
129_I	155_E	0.528	0.19
30_K	34_Y	0.524	0.19
100_I	133_M	0.523	0.19
70_L	81_S	0.523	0.19
92_K	156_N	0.519	0.19
21_L	25_I	0.518	0.19
6_T	65_Y	0.517	0.19
75_D	81_S	0.508	0.19
89_K	134_V	0.508	0.19
35_S	53_L	0.507	0.18
80_F	155_E	0.506	0.18
7_I	134_V	0.502	0.18
10_K	136_A	0.501	0.18
64_L	94_C	0.501	0.18
43_A	78_K	0.500	0.18

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2ksdA	1	0.4313	8.1	0.951	Contact Map
2mc7A	1	0.1875	6.8	0.953	Contact Map
1fftB	1	0.7	6.6	0.953	Contact Map
4a2nB	1	0.675	5.9	0.954	Contact Map
4il3A	1	0.9688	5.8	0.954	Contact Map
4aw6A	2	0.9375	5.1	0.955	Contact Map
4zwjA	1	0.95	5	0.956	Contact Map
3hb3B	1	0.6562	4.1	0.957	Contact Map
4yayA	1	0.8562	4.1	0.957	Contact Map
2k1eA	3	0.4562	3.3	0.959	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.