YNEN - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YNEN - Thioredoxin-like protein YneN

UniProt:	O31820	Sequences: MLKKWLAGILLIMLVGYTGWNLYQTYSKKEVGIQEGQQAPDFSLKTLSGEKSSLQDAKGKKVLLNFWATWCKPCRQEMPAMEKLQKEYADKLAVVAVNFTSAEKSEKQVRAFADTYDLTFPILIDKKGINADYNVMSYPTTYILDEKGVIQDIHVGTMTKKEMEQKLDLD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	170 (141)
Sequences:	10065 (7809)
Seq/√Len:	657.7

ECOLI - DSBE TPX BCP
BACSU - YNEN RESA STOA YKUV TPX BCP
HALSA - Q9HP28 Q9HQE6 Q9HRG4
SULSO - Q97WP9 Q97VL0 Q97WG5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
61_K	146_E	3.734	1.00
46_T	50_E	3.009	1.00
106_E	110_R	2.835	1.00
60_K	93_A	2.690	1.00
82_E	119_T	2.683	1.00
145_D	149_V	2.668	1.00
145_D	151_Q	2.414	1.00
45_K	51_K	2.294	1.00
82_E	86_K	2.271	1.00
43_S	51_K	2.261	1.00
53_S	56_D	2.105	1.00
43_S	53_S	2.003	1.00
52_S	57_A	1.961	1.00
62_V	93_A	1.960	1.00
38_Q	149_V	1.959	1.00
65_N	77_E	1.919	1.00
144_L	150_I	1.868	1.00
96_A	120_F	1.848	1.00
75_R	116_Y	1.792	1.00
63_L	143_I	1.791	1.00
87_E	164_E	1.789	1.00
105_S	108_Q	1.682	1.00
83_K	160_K	1.674	1.00
46_T	52_S	1.661	1.00
85_Q	89_A	1.635	1.00
39_A	133_Y	1.588	1.00
41_D	55_Q	1.516	1.00
61_K	143_I	1.512	1.00
65_N	141_T	1.506	1.00
98_N	109_V	1.433	1.00
110_R	114_D	1.430	1.00
75_R	115_T	1.414	1.00
80_A	83_K	1.396	1.00
162_E	165_Q	1.369	1.00
71_C	74_C	1.356	1.00
160_K	164_E	1.281	1.00
41_D	53_S	1.277	1.00
34_Q	37_Q	1.273	1.00
80_A	160_K	1.263	1.00
107_K	111_A	1.252	1.00
63_L	81_M	1.251	1.00
47_L	113_A	1.232	1.00
113_A	122_I	1.211	1.00
68_A	138_Y	1.206	1.00
63_L	92_L	1.198	1.00
106_E	124_I	1.197	1.00
63_L	141_T	1.190	1.00
78_M	118_L	1.184	1.00
83_K	86_K	1.169	1.00
77_E	141_T	1.166	1.00
88_Y	91_K	1.158	1.00
75_R	112_F	1.150	1.00
83_K	87_E	1.147	1.00
112_F	116_Y	1.142	1.00
76_Q	157_T	1.141	1.00
61_K	151_Q	1.138	1.00
100_T	104_K	1.137	1.00
16_G	20_W	1.134	1.00
69_T	109_V	1.134	1.00
44_L	123_L	1.132	1.00
36_G	149_V	1.126	1.00
62_V	144_L	1.125	1.00
111_A	115_T	1.117	1.00
99_F	138_Y	1.106	1.00
55_Q	58_K	1.104	1.00
109_V	124_I	1.103	1.00
66_F	133_Y	1.093	1.00
140_T	153_I	1.090	1.00
52_S	56_D	1.079	1.00
125_D	128_G	1.071	1.00
81_M	94_V	1.067	1.00
111_A	114_D	1.066	1.00
64_L	144_L	1.065	1.00
142_Y	150_I	1.059	1.00
87_E	160_K	1.050	1.00
72_K	76_Q	1.049	1.00
19_G	22_L	1.047	1.00
152_D	166_K	1.038	1.00
65_N	73_P	1.034	1.00
57_A	95_V	1.026	1.00
159_T	162_E	1.015	1.00
86_K	89_A	0.995	1.00
33_I	36_G	0.988	1.00
93_A	121_P	0.982	1.00
41_D	54_L	0.974	1.00
99_F	130_N	0.973	1.00
42_F	129_I	0.946	1.00
16_G	19_G	0.936	1.00
44_L	129_I	0.927	1.00
45_K	106_E	0.926	1.00
82_E	117_D	0.915	1.00
69_T	112_F	0.914	1.00
66_F	97_V	0.912	1.00
57_A	62_V	0.895	1.00
100_T	128_G	0.886	1.00
84_L	163_M	0.883	1.00
89_A	93_A	0.883	1.00
143_I	166_K	0.882	1.00
84_L	88_Y	0.877	1.00
161_K	164_E	0.866	1.00
54_L	58_K	0.848	1.00
82_E	120_F	0.833	1.00
62_V	95_V	0.829	1.00
143_I	152_D	0.827	1.00
144_L	148_G	0.819	1.00
85_Q	93_A	0.812	1.00
46_T	121_P	0.811	1.00
150_I	153_I	0.801	1.00
73_P	138_Y	0.800	1.00
35_E	152_D	0.798	1.00
78_M	116_Y	0.795	1.00
135_V	140_T	0.795	1.00
52_S	123_L	0.791	1.00
162_E	166_K	0.788	1.00
78_M	120_F	0.784	1.00
85_Q	119_T	0.783	1.00
107_K	110_R	0.783	1.00
18_T	21_N	0.782	1.00
54_L	62_V	0.768	1.00
58_K	62_V	0.768	1.00
70_W	138_Y	0.767	1.00
33_I	37_Q	0.761	1.00
86_K	119_T	0.757	1.00
42_F	54_L	0.755	1.00
108_Q	111_A	0.752	1.00
113_A	118_L	0.750	1.00
71_C	79_P	0.749	1.00
80_A	157_T	0.742	1.00
69_T	73_P	0.741	1.00
96_A	118_L	0.741	1.00
154_H	158_M	0.724	1.00
54_L	57_A	0.722	1.00
46_T	123_L	0.722	1.00
59_G	146_E	0.721	1.00
154_H	166_K	0.720	1.00
88_Y	164_E	0.715	1.00
129_I	132_D	0.715	1.00
47_L	110_R	0.708	1.00
130_N	135_V	0.700	1.00
73_P	157_T	0.699	1.00
143_I	154_H	0.687	1.00
18_T	22_L	0.684	1.00
72_K	75_R	0.674	1.00
81_M	141_T	0.670	1.00
79_P	83_K	0.669	1.00
38_Q	58_K	0.669	1.00
96_A	122_I	0.662	1.00
160_K	163_M	0.660	1.00
80_A	84_L	0.660	1.00
62_V	148_G	0.659	1.00
78_M	82_E	0.658	1.00
59_G	148_G	0.655	1.00
66_F	135_V	0.653	1.00
66_F	129_I	0.651	1.00
109_V	112_F	0.649	1.00
48_S	110_R	0.649	1.00
67_W	122_I	0.640	1.00
154_H	157_T	0.639	1.00
104_K	108_Q	0.634	1.00
58_K	148_G	0.632	1.00
85_Q	88_Y	0.628	1.00
35_E	153_I	0.628	1.00
81_M	96_A	0.625	1.00
84_L	87_E	0.621	1.00
109_V	122_I	0.619	1.00
65_N	81_M	0.614	1.00
113_A	117_D	0.611	1.00
31_V	34_Q	0.606	1.00
61_K	92_L	0.600	1.00
140_T	155_V	0.599	1.00
73_P	79_P	0.598	1.00
71_C	139_P	0.597	1.00
77_E	157_T	0.594	1.00
45_K	126_K	0.591	1.00
59_G	62_V	0.590	1.00
63_L	94_V	0.589	1.00
161_K	165_Q	0.589	1.00
82_E	116_Y	0.588	1.00
129_I	133_Y	0.588	1.00
82_E	85_Q	0.580	1.00
67_W	78_M	0.580	1.00
78_M	112_F	0.580	1.00
97_V	125_D	0.579	1.00
76_Q	80_A	0.570	1.00
46_T	49_G	0.562	1.00
79_P	139_P	0.561	1.00
45_K	49_G	0.561	1.00
85_Q	120_F	0.560	1.00
69_T	78_M	0.558	1.00
75_R	78_M	0.554	1.00
74_C	79_P	0.551	1.00
76_Q	79_P	0.550	1.00
114_D	117_D	0.548	1.00
137_S	140_T	0.546	1.00
158_M	163_M	0.545	1.00
135_V	142_Y	0.540	1.00
68_A	98_N	0.534	1.00
39_A	64_L	0.533	1.00
118_L	122_I	0.533	1.00
84_L	94_V	0.530	0.99
68_A	73_P	0.529	0.99
52_S	121_P	0.528	0.99
71_C	116_Y	0.528	0.99
65_N	78_M	0.528	0.99
88_Y	92_L	0.516	0.99
125_D	130_N	0.510	0.99
32_G	36_G	0.508	0.99
59_G	145_D	0.507	0.99
67_W	98_N	0.503	0.99
131_A	136_M	0.502	0.99
64_L	133_Y	0.502	0.99
97_V	129_I	0.500	0.99

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2hyxA	2	0.9647	100	0.322	Contact Map
3eytA	4	0.8059	100	0.347	Contact Map
3lorA	3	0.8059	100	0.357	Contact Map
3eurA	1	0.7824	100	0.357	Contact Map
2p5qA	3	0.7882	100	0.366	Contact Map
4yodA	1	0.9647	100	0.368	Contact Map
3fw2A	2	0.7882	100	0.371	Contact Map
2ggtA	1	0.7882	100	0.372	Contact Map
3hczA	2	0.8118	100	0.373	Contact Map
2f9sA	1	0.7882	100	0.374	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0066 seconds.