YNZC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YNZC - UPF0291 protein YnzC

UniProt:	O31818	Sequences: MISNAKIARINELAAKAKAGVITEEEKAEQQKLRQEYLKGFRSSMKNTLKSVKIIDPEGNDVTPEKLKREQRNNKLH	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	77 (71)
Sequences:	415 (273)
Seq/√Len:	32.4

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
6_K	36_E	3.371	1.00
50_K	70_E	3.265	1.00
9_R	29_E	3.129	1.00
15_A	19_A	2.642	1.00
31_Q	35_Q	2.270	0.99
45_M	48_T	2.267	0.99
65_E	69_R	2.265	0.99
4_N	8_A	2.234	0.99
55_I	61_D	2.163	0.99
16_K	20_G	2.078	0.98
30_Q	34_R	1.772	0.95
46_K	50_K	1.719	0.94
16_K	21_V	1.457	0.88
49_L	67_L	1.433	0.87
17_A	30_Q	1.433	0.87
49_L	74_N	1.415	0.86
40_G	43_S	1.398	0.85
27_K	30_Q	1.380	0.85
48_T	52_V	1.347	0.83
16_K	26_E	1.333	0.82
69_R	73_N	1.309	0.81
50_K	74_N	1.290	0.80
44_S	47_N	1.284	0.80
49_L	52_V	1.263	0.79
7_I	37_Y	1.251	0.78
53_K	61_D	1.230	0.77
27_K	31_Q	1.224	0.77
57_P	67_L	1.201	0.75
41_F	45_M	1.192	0.75
46_K	49_L	1.158	0.73
67_L	71_Q	1.122	0.70
53_K	68_K	1.045	0.64
17_A	27_K	1.020	0.63
56_D	60_N	1.019	0.63
9_R	12_E	1.018	0.62
48_T	54_I	1.009	0.62
13_L	29_E	1.007	0.62
19_A	24_E	0.999	0.61
47_N	51_S	0.981	0.60
46_K	70_E	0.972	0.59
70_E	73_N	0.923	0.55
41_F	44_S	0.912	0.54
57_P	60_N	0.903	0.53
51_S	55_I	0.876	0.51
32_K	35_Q	0.849	0.49
53_K	72_R	0.841	0.48
70_E	74_N	0.821	0.46
22_I	30_Q	0.801	0.45
40_G	45_M	0.801	0.45
61_D	64_P	0.766	0.42
37_Y	53_K	0.753	0.41
57_P	61_D	0.746	0.40
41_F	49_L	0.744	0.40
67_L	70_E	0.740	0.40
65_E	73_N	0.722	0.38
28_A	31_Q	0.711	0.38
12_E	24_E	0.709	0.37
27_K	35_Q	0.708	0.37
14_A	34_R	0.707	0.37
51_S	67_L	0.706	0.37
45_M	54_I	0.703	0.37
10_I	21_V	0.689	0.36
37_Y	40_G	0.682	0.35
9_R	13_L	0.681	0.35
61_D	71_Q	0.679	0.35
5_A	24_E	0.670	0.34
8_A	12_E	0.668	0.34
43_S	72_R	0.657	0.34
45_M	68_K	0.652	0.33
28_A	32_K	0.649	0.33
49_L	70_E	0.647	0.33
53_K	57_P	0.639	0.32
25_E	52_V	0.637	0.32
17_A	34_R	0.636	0.32
6_K	9_R	0.630	0.32
14_A	37_Y	0.626	0.31
6_K	40_G	0.625	0.31
65_E	72_R	0.625	0.31
14_A	17_A	0.621	0.31
14_A	64_P	0.617	0.31
18_K	37_Y	0.612	0.30
21_V	30_Q	0.609	0.30
24_E	27_K	0.608	0.30
38_L	54_I	0.603	0.30
7_I	18_K	0.596	0.29
45_M	49_L	0.589	0.29
41_F	50_K	0.584	0.28
48_T	51_S	0.577	0.28
28_A	68_K	0.568	0.27
44_S	48_T	0.566	0.27
51_S	61_D	0.559	0.27
41_F	51_S	0.557	0.27
61_D	68_K	0.546	0.26
22_I	27_K	0.537	0.25
10_I	22_I	0.535	0.25
4_N	17_A	0.528	0.25
51_S	72_R	0.526	0.25
57_P	71_Q	0.520	0.24
39_K	60_N	0.514	0.24
28_A	48_T	0.509	0.24
7_I	39_K	0.509	0.24
7_I	24_E	0.508	0.24
36_E	42_R	0.504	0.23
36_E	48_T	0.503	0.23
5_A	12_E	0.500	0.23
31_Q	39_K	0.500	0.23

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2hepA	1	0.5455	100	0.073	Contact Map
3bhpA	3	0.7013	99.8	0.41	Contact Map
2jvdA	1	0.6234	99.7	0.46	Contact Map
4im9A	1	0.5714	54.1	0.882	Contact Map
1t3wA	4	0.5195	52.1	0.883	Contact Map
3r15A	1	0.7532	41.9	0.89	Contact Map
3b0cT	1	0.6883	19.3	0.907	Contact Map
4n2kA	2	0.961	18.6	0.908	Contact Map
2dewX	2	1	18.6	0.908	Contact Map
1t11A	3	0.9221	17.6	0.909	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0048 seconds.