FOSB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

FOSB - Metallothiol transferase FosB

UniProt:	O31817	Sequences: MEIKGINHLLFSVSHLDTSIDFYQKVFGAKLLVKGRTTAYFDMNGIWLALNEEPDIPRNDIKLSYTHIAFTIEDHEFEEMSAKLKRLHVNILPGRERDERDRKSIYFTDPDGHKFEFHTGTLQDRLRYYKQEKTHMHFYDETAF	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	144 (130)
Sequences:	409 (298)
Seq/√Len:	26.2

BACSU - FOSB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
20_I	31_L	4.468	1.00
72_I	80_M	3.914	1.00
129_Y	136_M	3.488	1.00
84_L	89_V	3.364	1.00
80_M	117_F	3.219	1.00
81_S	105_I	2.929	1.00
10_L	38_T	2.868	1.00
21_D	25_K	2.710	0.99
10_L	48_L	2.392	0.99
33_V	136_M	2.311	0.98
12_S	53_E	2.293	0.98
29_A	43_M	2.256	0.98
72_I	105_I	2.244	0.98
37_T	52_E	2.175	0.97
72_I	119_T	2.078	0.96
19_S	23_Y	2.051	0.96
77_F	81_S	2.000	0.96
82_A	86_R	1.774	0.92
68_I	129_Y	1.748	0.91
85_K	94_G	1.714	0.90
73_E	76_E	1.674	0.89
26_V	87_L	1.589	0.86
78_E	103_K	1.574	0.86
5_G	46_I	1.550	0.85
81_S	85_K	1.522	0.84
17_D	34_K	1.448	0.81
6_I	46_I	1.423	0.79
74_D	119_T	1.407	0.79
43_M	48_L	1.384	0.77
66_T	113_H	1.367	0.77
22_F	110_P	1.356	0.76
35_G	38_T	1.347	0.75
4_K	73_E	1.344	0.75
74_D	103_K	1.342	0.75
65_Y	106_Y	1.338	0.75
33_V	129_Y	1.308	0.73
64_S	114_K	1.277	0.71
27_F	44_N	1.274	0.71
42_D	45_G	1.246	0.70
7_N	71_T	1.238	0.69
78_E	105_I	1.212	0.67
9_L	123_Q	1.212	0.67
3_I	43_M	1.211	0.67
22_F	26_V	1.178	0.65
50_L	66_T	1.170	0.65
55_D	60_D	1.169	0.64
19_S	22_F	1.164	0.64
3_I	34_K	1.156	0.64
51_N	95_R	1.147	0.63
65_Y	113_H	1.136	0.62
15_H	86_R	1.134	0.62
15_H	18_T	1.122	0.61
31_L	39_A	1.081	0.58
20_I	39_A	1.062	0.57
14_S	54_P	1.058	0.57
15_H	88_H	1.056	0.56
22_F	89_V	1.053	0.56
80_M	83_K	1.044	0.56
32_L	42_D	1.043	0.56
27_F	76_E	1.043	0.56
19_S	110_P	1.022	0.54
32_L	44_N	1.000	0.52
24_Q	31_L	0.973	0.50
23_Y	40_Y	0.964	0.50
51_N	65_Y	0.961	0.49
100_R	131_Q	0.956	0.49
11_F	49_A	0.951	0.49
134_T	137_H	0.949	0.49
36_R	134_T	0.926	0.47
77_F	119_T	0.919	0.46
21_D	79_E	0.917	0.46
38_T	100_R	0.909	0.46
34_K	137_H	0.904	0.45
40_Y	110_P	0.902	0.45
107_F	129_Y	0.893	0.44
77_F	85_K	0.891	0.44
68_I	136_M	0.884	0.44
106_Y	113_H	0.869	0.43
29_A	48_L	0.869	0.43
23_Y	110_P	0.869	0.43
27_F	80_M	0.864	0.42
3_I	46_I	0.856	0.42
39_A	110_P	0.842	0.41
93_P	96_E	0.836	0.40
50_L	110_P	0.833	0.40
82_A	137_H	0.831	0.40
108_T	114_K	0.829	0.40
95_R	129_Y	0.822	0.39
35_G	98_D	0.812	0.39
73_E	82_A	0.810	0.39
9_L	46_I	0.804	0.38
72_I	77_F	0.793	0.37
74_D	88_H	0.767	0.36
123_Q	127_R	0.766	0.35
18_T	131_Q	0.748	0.34
89_V	107_F	0.745	0.34
5_G	8_H	0.744	0.34
9_L	68_I	0.742	0.34
7_N	40_Y	0.736	0.33
33_V	66_T	0.729	0.33
10_L	137_H	0.727	0.33
86_R	103_K	0.724	0.33
106_Y	118_H	0.723	0.33
105_I	119_T	0.723	0.33
7_N	12_S	0.722	0.33
23_Y	39_A	0.721	0.32
46_I	113_H	0.721	0.32
11_F	113_H	0.720	0.32
31_L	136_M	0.720	0.32
71_T	123_Q	0.716	0.32
31_L	121_T	0.715	0.32
93_P	103_K	0.715	0.32
38_T	98_D	0.713	0.32
119_T	132_E	0.711	0.32
36_R	135_H	0.710	0.32
18_T	30_K	0.710	0.32
37_T	137_H	0.707	0.32
19_S	50_L	0.702	0.31
74_D	86_R	0.699	0.31
85_K	88_H	0.697	0.31
19_S	40_Y	0.696	0.31
30_K	48_L	0.694	0.31
12_S	66_T	0.691	0.31
44_N	76_E	0.687	0.30
64_S	95_R	0.682	0.30
73_E	86_R	0.680	0.30
37_T	131_Q	0.675	0.30
18_T	127_R	0.665	0.29
53_E	101_D	0.660	0.29
113_H	120_G	0.657	0.28
5_G	44_N	0.656	0.28
63_L	93_P	0.655	0.28
56_I	63_L	0.655	0.28
101_D	135_H	0.653	0.28
54_P	131_Q	0.638	0.27
30_K	82_A	0.635	0.27
22_F	40_Y	0.633	0.27
60_D	123_Q	0.633	0.27
4_K	71_T	0.632	0.27
89_V	122_L	0.628	0.27
75_H	82_A	0.623	0.26
49_A	95_R	0.617	0.26
7_N	23_Y	0.616	0.26
82_A	131_Q	0.615	0.26
12_S	64_S	0.611	0.26
25_K	80_M	0.610	0.26
6_I	72_I	0.606	0.25
18_T	88_H	0.599	0.25
28_G	73_E	0.596	0.25
59_N	63_L	0.591	0.25
59_N	123_Q	0.582	0.24
123_Q	132_E	0.582	0.24
77_F	124_D	0.581	0.24
10_L	101_D	0.579	0.24
81_S	127_R	0.577	0.24
73_E	93_P	0.577	0.24
35_G	101_D	0.575	0.24
18_T	54_P	0.575	0.24
35_G	95_R	0.572	0.24
44_N	96_E	0.572	0.24
18_T	25_K	0.569	0.23
17_D	31_L	0.565	0.23
6_I	42_D	0.562	0.23
61_I	64_S	0.562	0.23
22_F	39_A	0.556	0.23
33_V	51_N	0.555	0.23
18_T	86_R	0.554	0.23
12_S	23_Y	0.553	0.23
94_G	119_T	0.552	0.23
26_V	130_K	0.551	0.23
101_D	133_K	0.551	0.23
72_I	131_Q	0.551	0.23
21_D	86_R	0.548	0.22
34_K	39_A	0.543	0.22
85_K	89_V	0.543	0.22
71_T	121_T	0.539	0.22
106_Y	114_K	0.538	0.22
127_R	131_Q	0.537	0.22
106_Y	126_L	0.536	0.22
74_D	121_T	0.532	0.22
43_M	84_L	0.531	0.21
12_S	51_N	0.530	0.21
54_P	82_A	0.528	0.21
23_Y	50_L	0.527	0.21
70_F	107_F	0.524	0.21
55_D	78_E	0.521	0.21
38_T	101_D	0.521	0.21
116_E	125_R	0.520	0.21
17_D	20_I	0.519	0.21
101_D	106_Y	0.517	0.21
11_F	65_Y	0.510	0.20
93_P	127_R	0.505	0.20
10_L	102_R	0.504	0.20
35_G	40_Y	0.501	0.20
53_E	96_E	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4jh2A	2	0.9583	100	0.586	Contact Map
4ir0A	2	1	99.9	0.589	Contact Map
2p7oA	2	0.8333	99.9	0.603	Contact Map
4nazA	2	0.9028	99.9	0.605	Contact Map
1nkiA	2	0.9236	99.9	0.606	Contact Map
1npbA	3	0.9583	99.9	0.621	Contact Map
1r9cA	2	0.8333	99.9	0.647	Contact Map
3kolA	2	0.8333	99.8	0.671	Contact Map
2p25A	2	0.8125	99.8	0.677	Contact Map
2rk0A	4	0.875	99.8	0.678	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0061 seconds.