YLQC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YLQC - UPF0109 protein YlqC

UniProt:	O31738	Sequences: MTDQHLEDLIVHIVTPLVDHPDDIRVIREETDQKIALRLSVHKSDTGKVIGKQGRTAKAIRTAVFAAGVQSSKKVQFEIFD	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	81 (75)
Sequences:	831 (533)
Seq/√Len:	61.5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
64_V	77_F	3.659	1.00
11_V	15_T	3.268	1.00
14_V	39_L	3.153	1.00
57_A	79_I	2.994	1.00
23_D	42_H	2.882	1.00
10_I	37_L	2.534	1.00
7_E	11_V	2.515	1.00
39_L	77_F	2.315	1.00
20_H	23_D	2.281	1.00
7_E	28_R	2.045	1.00
20_H	42_H	1.905	1.00
29_E	38_R	1.867	1.00
25_R	40_S	1.735	0.99
41_V	49_V	1.707	0.99
19_D	48_K	1.687	0.99
12_H	16_P	1.564	0.99
10_I	64_V	1.537	0.99
15_T	24_I	1.468	0.98
27_I	38_R	1.386	0.97
34_K	76_Q	1.383	0.97
36_A	76_Q	1.362	0.97
30_E	73_K	1.247	0.95
14_V	26_V	1.233	0.94
46_T	65_F	1.223	0.94
10_I	77_F	1.214	0.94
38_R	80_F	1.201	0.93
53_Q	58_K	1.146	0.92
14_V	60_I	1.080	0.89
18_V	24_I	1.074	0.89
46_T	56_T	1.074	0.89
29_E	33_Q	1.071	0.89
68_G	75_V	1.064	0.89
46_T	60_I	1.062	0.88
39_L	79_I	1.058	0.88
63_A	66_A	1.053	0.88
39_L	64_V	1.028	0.87
42_H	65_F	1.027	0.87
65_F	77_F	1.016	0.86
52_K	74_K	0.979	0.84
37_L	64_V	0.970	0.83
14_V	57_A	0.888	0.78
66_A	79_I	0.887	0.78
13_I	63_A	0.864	0.76
7_E	37_L	0.854	0.75
6_L	13_I	0.844	0.74
13_I	39_L	0.843	0.74
10_I	16_P	0.843	0.74
62_T	80_F	0.841	0.74
31_T	34_K	0.839	0.73
67_A	77_F	0.836	0.73
20_H	44_S	0.770	0.67
63_A	68_G	0.742	0.64
9_L	17_L	0.729	0.63
52_K	69_V	0.728	0.63
65_F	74_K	0.725	0.62
58_K	78_E	0.720	0.62
17_L	23_D	0.707	0.60
45_D	66_A	0.703	0.60
11_V	66_A	0.690	0.58
35_I	70_Q	0.669	0.56
8_D	79_I	0.668	0.56
26_V	80_F	0.664	0.56
38_R	48_K	0.662	0.55
55_R	65_F	0.662	0.55
23_D	30_E	0.655	0.55
15_T	21_P	0.654	0.54
49_V	79_I	0.653	0.54
25_R	28_R	0.653	0.54
12_H	59_A	0.645	0.53
9_L	48_K	0.639	0.53
68_G	71_S	0.637	0.52
40_S	70_Q	0.630	0.52
12_H	56_T	0.628	0.51
57_A	62_T	0.626	0.51
33_Q	74_K	0.621	0.51
13_I	58_K	0.620	0.51
6_L	71_S	0.618	0.50
19_D	44_S	0.614	0.50
25_R	44_S	0.601	0.48
17_L	66_A	0.597	0.48
24_I	39_L	0.589	0.47
35_I	75_V	0.582	0.46
25_R	29_E	0.581	0.46
9_L	63_A	0.580	0.46
31_T	78_E	0.580	0.46
36_A	63_A	0.578	0.46
76_Q	80_F	0.577	0.46
34_K	38_R	0.576	0.46
53_Q	70_Q	0.572	0.45
31_T	38_R	0.571	0.45
39_L	57_A	0.571	0.45
26_V	37_L	0.570	0.45
8_D	11_V	0.558	0.44
48_K	79_I	0.556	0.43
65_F	76_Q	0.553	0.43
18_V	41_V	0.552	0.43
17_L	53_Q	0.544	0.42
56_T	79_I	0.544	0.42
23_D	44_S	0.539	0.41
56_T	75_V	0.534	0.41
19_D	78_E	0.533	0.41
32_D	72_S	0.533	0.41
26_V	41_V	0.525	0.40
13_I	52_K	0.520	0.39
36_A	78_E	0.519	0.39
52_K	59_A	0.514	0.39
9_L	65_F	0.511	0.38
68_G	77_F	0.503	0.38
55_R	58_K	0.502	0.37
6_L	78_E	0.501	0.37
12_H	52_K	0.500	0.37
10_I	65_F	0.500	0.37

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3gkuA	2	0.963	99.3	0.571	Contact Map
2pt7G	2	0.9506	99.2	0.603	Contact Map
2cxcA	1	0.8148	98.1	0.721	Contact Map
2jzxA	1	0.5185	93.1	0.828	Contact Map
2axyA	2	0.5185	92.2	0.833	Contact Map
2anrA	1	0.5926	92.1	0.834	Contact Map
1j4wA	1	0.4938	90.6	0.84	Contact Map
2p2rA	1	0.4938	90.5	0.84	Contact Map
1zzkA	1	0.5185	90.4	0.841	Contact Map
2jvzA	1	0.5802	90.2	0.841	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.