YLQB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YLQB - Uncharacterized protein YlqB

UniProt:	O31737	Sequences: MKKIGLLFMLCLAALFTIGFPAQQADAAEAPYKASITNISTDGGVYGKINYGQGQYWRVKYNITVSGKLLDQNGQPVPNAPVRFEADTKVGNTTQTASGTTDANGTFEVPMYLGPAAGYYTYYTSVSVHYYDIIPFRVFSGESRLVSTDNSLYHFAYQVRR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	161 (129)
Sequences:	627 (556)
Seq/√Len:	49.0

BACSU - YLQB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
67_G	84_F	4.774	1.00
71_D	75_Q	3.947	1.00
67_G	109_V	3.143	1.00
102_D	106_T	3.024	1.00
101_T	107_F	3.020	1.00
141_G	145_L	2.439	1.00
70_L	74_G	2.354	1.00
38_N	41_T	2.271	1.00
102_D	107_F	2.229	1.00
107_F	124_T	2.113	1.00
141_G	147_S	2.079	1.00
77_V	80_A	2.045	1.00
24_Q	29_E	2.010	1.00
22_A	26_D	2.009	1.00
67_G	107_F	1.949	0.99
94_T	97_A	1.896	0.99
82_V	107_F	1.864	0.99
26_D	30_A	1.805	0.99
107_F	114_G	1.771	0.99
147_S	150_N	1.745	0.99
141_G	144_R	1.718	0.98
68_K	106_T	1.696	0.98
66_S	106_T	1.657	0.98
58_R	61_Y	1.627	0.98
67_G	124_T	1.578	0.97
82_V	124_T	1.572	0.97
96_T	101_T	1.552	0.97
84_F	99_G	1.545	0.97
84_F	109_V	1.535	0.97
26_D	29_E	1.527	0.97
99_G	107_F	1.410	0.95
20_F	25_A	1.384	0.94
23_Q	30_A	1.318	0.93
34_A	38_N	1.317	0.93
56_Y	145_L	1.292	0.92
78_P	103_A	1.257	0.91
22_A	29_E	1.248	0.90
70_L	129_H	1.239	0.90
84_F	122_Y	1.238	0.90
65_V	84_F	1.204	0.89
126_V	129_H	1.203	0.89
21_P	24_Q	1.184	0.88
67_G	114_G	1.175	0.88
62_N	110_P	1.166	0.87
52_G	128_V	1.142	0.86
138_V	141_G	1.133	0.86
24_Q	30_A	1.132	0.86
87_D	121_T	1.131	0.85
23_Q	26_D	1.115	0.85
81_P	100_T	1.111	0.84
48_K	52_G	1.096	0.84
146_V	150_N	1.094	0.84
21_P	32_Y	1.071	0.82
71_D	77_V	1.070	0.82
83_R	98_S	1.057	0.81
47_G	50_N	1.046	0.81
143_S	147_S	1.041	0.80
137_R	140_S	1.038	0.80
29_E	32_Y	1.031	0.80
59_V	115_P	1.027	0.79
84_F	114_G	1.026	0.79
103_A	106_T	1.025	0.79
137_R	144_R	1.018	0.79
69_L	82_V	1.006	0.78
94_T	109_V	1.000	0.78
67_G	111_M	0.976	0.76
69_L	102_D	0.966	0.75
22_A	25_A	0.966	0.75
66_S	108_E	0.955	0.74
46_Y	80_A	0.944	0.73
143_S	148_T	0.927	0.72
20_F	24_Q	0.923	0.72
97_A	108_E	0.898	0.70
93_T	97_A	0.896	0.69
79_N	112_Y	0.885	0.68
50_N	85_E	0.884	0.68
141_G	146_V	0.882	0.68
51_Y	95_Q	0.882	0.68
111_M	125_S	0.878	0.68
45_V	48_K	0.875	0.68
77_V	101_T	0.874	0.67
140_S	145_L	0.859	0.66
108_E	134_I	0.847	0.65
111_M	127_S	0.847	0.65
69_L	77_V	0.840	0.64
26_D	49_I	0.839	0.64
62_N	112_Y	0.837	0.64
46_Y	49_I	0.827	0.63
139_F	144_R	0.825	0.63
98_S	101_T	0.822	0.63
48_K	51_Y	0.819	0.62
55_Q	63_I	0.816	0.62
45_V	52_G	0.814	0.62
144_R	147_S	0.808	0.61
40_S	111_M	0.807	0.61
99_G	110_P	0.804	0.61
21_P	76_P	0.802	0.61
84_F	94_T	0.798	0.60
114_G	118_G	0.789	0.59
142_E	147_S	0.789	0.59
84_F	107_F	0.782	0.59
77_V	128_V	0.781	0.59
120_Y	124_T	0.779	0.59
84_F	87_D	0.774	0.58
146_V	149_D	0.774	0.58
67_G	120_Y	0.771	0.58
109_V	114_G	0.771	0.58
30_A	41_T	0.769	0.58
121_T	135_P	0.762	0.57
27_A	30_A	0.762	0.57
58_R	141_G	0.760	0.57
58_R	138_V	0.758	0.56
70_L	136_F	0.756	0.56
37_T	125_S	0.754	0.56
24_Q	59_V	0.754	0.56
72_Q	117_A	0.746	0.55
45_V	54_G	0.743	0.55
114_G	136_F	0.736	0.54
111_M	126_V	0.734	0.54
82_V	102_D	0.729	0.54
59_V	112_Y	0.727	0.53
30_A	35_S	0.717	0.52
19_G	22_A	0.700	0.51
136_F	139_F	0.698	0.50
140_S	144_R	0.696	0.50
47_G	51_Y	0.690	0.50
32_Y	38_N	0.689	0.49
79_N	101_T	0.688	0.49
44_G	83_R	0.683	0.49
91_G	94_T	0.682	0.49
47_G	52_G	0.682	0.49
65_V	122_Y	0.681	0.49
48_K	53_Q	0.679	0.48
56_Y	80_A	0.679	0.48
30_A	37_T	0.674	0.48
25_A	28_A	0.674	0.48
40_S	62_N	0.665	0.47
95_Q	115_P	0.659	0.46
25_A	29_E	0.653	0.46
32_Y	35_S	0.640	0.45
139_F	142_E	0.636	0.44
34_A	37_T	0.623	0.43
111_M	122_Y	0.619	0.42
138_V	150_N	0.612	0.42
139_F	146_V	0.610	0.42
57_W	63_I	0.610	0.42
125_S	134_I	0.609	0.41
72_Q	102_D	0.607	0.41
25_A	31_P	0.605	0.41
59_V	77_V	0.600	0.41
142_E	150_N	0.598	0.40
22_A	36_I	0.597	0.40
20_F	32_Y	0.597	0.40
95_Q	100_T	0.597	0.40
53_Q	63_I	0.595	0.40
38_N	42_D	0.595	0.40
56_Y	61_Y	0.594	0.40
65_V	134_I	0.592	0.40
24_Q	28_A	0.591	0.40
39_I	123_Y	0.588	0.39
139_F	148_T	0.587	0.39
58_R	120_Y	0.587	0.39
85_E	125_S	0.586	0.39
19_G	24_Q	0.580	0.39
23_Q	36_I	0.579	0.39
121_T	124_T	0.578	0.38
33_K	116_A	0.577	0.38
62_N	79_N	0.574	0.38
46_Y	52_G	0.569	0.38
35_S	43_G	0.564	0.37
55_Q	117_A	0.558	0.37
108_E	116_A	0.550	0.36
125_S	129_H	0.549	0.36
79_N	104_N	0.549	0.36
82_V	126_V	0.541	0.35
69_L	78_P	0.539	0.35
92_N	96_T	0.538	0.35
100_T	108_E	0.534	0.34
84_F	124_T	0.533	0.34
144_R	150_N	0.531	0.34
34_A	41_T	0.526	0.34
32_Y	75_Q	0.524	0.33
73_N	81_P	0.518	0.33
77_V	104_N	0.514	0.32
77_V	129_H	0.513	0.32
129_H	133_I	0.508	0.32
112_Y	125_S	0.508	0.32
70_L	81_P	0.507	0.32
31_P	35_S	0.506	0.32
78_P	116_A	0.505	0.32
139_F	147_S	0.503	0.32
33_K	36_I	0.502	0.31
58_R	115_P	0.501	0.31
23_Q	27_A	0.500	0.31

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1cwvA	1	0.7081	99.2	0.506	Contact Map
4e9lA	1	0.8634	99.1	0.524	Contact Map
1f00I	1	0.6894	99	0.548	Contact Map
1wlhA	2	0.9441	96.9	0.727	Contact Map
4umgA	1	0.6335	96.7	0.736	Contact Map
2di7A	1	0.7329	95.9	0.754	Contact Map
2ds4A	1	0.6832	95.7	0.758	Contact Map
3e8vA	1	0.5031	95.6	0.76	Contact Map
3gm8A	1	0.8199	95.4	0.764	Contact Map
1qfhA	2	0.7516	95.3	0.766	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.