YLMC - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YLMC - Uncharacterized protein YlmC

UniProt:	O31725	Sequences: MISISEFQVKDVVNVSNGKKLGSIGDIDINVTTGKIQAIILGGNGKVLGFFGKEEELVIPWRNIVKIGEDVILVRLSEPHA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	81 (76)
Sequences:	467 (345)
Seq/√Len:	39.6

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
14_N	17_N	3.362	1.00
30_N	37_Q	3.276	1.00
65_V	75_R	3.210	1.00
11_D	20_K	2.837	1.00
12_V	24_I	2.505	1.00
16_S	75_R	2.163	0.99
29_I	36_I	2.075	0.99
11_D	42_G	2.047	0.99
39_I	64_I	1.984	0.99
10_K	28_D	1.942	0.99
18_G	71_V	1.846	0.98
18_G	66_K	1.712	0.97
51_F	65_V	1.681	0.96
35_K	47_V	1.662	0.96
24_I	72_I	1.451	0.92
17_N	25_G	1.390	0.90
44_N	57_L	1.373	0.90
11_D	23_S	1.368	0.90
2_I	42_G	1.341	0.89
26_D	70_D	1.314	0.88
60_P	63_N	1.302	0.87
49_G	52_G	1.295	0.87
9_V	29_I	1.229	0.84
64_I	67_I	1.225	0.84
18_G	35_K	1.221	0.84
31_V	36_I	1.221	0.84
43_G	56_E	1.218	0.83
34_G	66_K	1.205	0.83
35_K	62_R	1.199	0.82
17_N	24_I	1.191	0.82
10_K	34_G	1.186	0.82
38_A	58_V	1.146	0.79
3_S	69_E	1.132	0.79
12_V	42_G	1.132	0.79
15_V	73_L	1.092	0.76
27_I	71_V	1.079	0.75
2_I	29_I	1.058	0.74
8_Q	13_V	0.988	0.68
5_S	56_E	0.986	0.68
41_L	57_L	0.965	0.67
13_V	45_G	0.950	0.65
29_I	33_T	0.933	0.64
5_S	66_K	0.928	0.63
13_V	18_G	0.905	0.61
60_P	66_K	0.905	0.61
25_G	46_K	0.893	0.60
46_K	49_G	0.870	0.58
51_F	55_E	0.869	0.58
30_N	77_S	0.864	0.58
46_K	73_L	0.862	0.58
53_K	61_W	0.858	0.57
38_A	61_W	0.841	0.56
21_L	67_I	0.824	0.54
25_G	41_L	0.823	0.54
20_K	27_I	0.821	0.54
40_I	47_V	0.817	0.54
47_V	51_F	0.815	0.53
37_Q	62_R	0.813	0.53
39_I	66_K	0.810	0.53
21_L	75_R	0.794	0.52
57_L	77_S	0.780	0.50
47_V	54_E	0.776	0.50
4_I	28_D	0.773	0.50
18_G	55_E	0.767	0.49
43_G	53_K	0.748	0.47
29_I	50_F	0.728	0.46
41_L	44_N	0.719	0.45
25_G	66_K	0.715	0.44
4_I	27_I	0.708	0.44
34_G	41_L	0.707	0.44
41_L	62_R	0.705	0.43
43_G	49_G	0.695	0.43
6_E	31_V	0.694	0.43
15_V	65_V	0.681	0.41
21_L	76_L	0.670	0.40
4_I	31_V	0.665	0.40
13_V	33_T	0.657	0.39
41_L	59_I	0.654	0.39
19_K	51_F	0.647	0.38
11_D	63_N	0.646	0.38
20_K	55_E	0.642	0.38
14_N	33_T	0.640	0.38
16_S	63_N	0.634	0.37
43_G	54_E	0.632	0.37
2_I	69_E	0.631	0.37
24_I	39_I	0.612	0.35
10_K	69_E	0.612	0.35
4_I	39_I	0.603	0.35
54_E	62_R	0.602	0.35
19_K	71_V	0.601	0.34
26_D	73_L	0.586	0.33
19_K	72_I	0.582	0.33
61_W	69_E	0.581	0.33
7_F	76_L	0.580	0.33
18_G	69_E	0.576	0.32
7_F	63_N	0.556	0.31
8_Q	71_V	0.553	0.31
44_N	48_L	0.548	0.30
15_V	18_G	0.548	0.30
40_I	73_L	0.546	0.30
9_V	73_L	0.530	0.29
8_Q	23_S	0.526	0.29
48_L	59_I	0.522	0.28
14_N	76_L	0.522	0.28
30_N	33_T	0.518	0.28
33_T	51_F	0.517	0.28
6_E	37_Q	0.516	0.28
27_I	55_E	0.515	0.28
18_G	31_V	0.514	0.28
56_E	73_L	0.508	0.27
32_T	62_R	0.504	0.27
9_V	54_E	0.501	0.27
59_I	69_E	0.501	0.27
42_G	47_V	0.500	0.27

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1pm3A	2	0.8519	99.8	0.405	Contact Map
3htrA	2	0.9383	99.4	0.585	Contact Map
1eysH	1	0.8889	96.2	0.806	Contact Map
1rzhH	1	0.8765	95.6	0.816	Contact Map
2wjnH	1	0.8889	95	0.823	Contact Map
4da2A	1	0.9012	37.4	0.901	Contact Map
1a62A	1	0.9753	25	0.91	Contact Map
2dyiA	1	0.9012	23.3	0.911	Contact Map
2qggA	1	0.8889	13.7	0.92	Contact Map
2f1lA	2	0.8765	12.9	0.921	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.005 seconds.