YKZG - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YKZG - UPF0356 protein YkzG

UniProt:	O31718	Sequences: MIYKVFYQEKADEVPVREKTDSLYIEGVSERDVRTKLKEKKFNIEFITPVDGAFLEYEQQSENFKVLEL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	69 (68)
Sequences:	297 (194)
Seq/√Len:	23.5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
6_F	54_F	2.769	0.99
52_G	59_Q	2.636	0.99
7_Y	23_L	2.456	0.98
52_G	56_E	2.383	0.98
30_E	46_F	2.358	0.98
30_E	49_P	2.106	0.95
9_E	21_D	2.097	0.95
31_R	48_T	1.865	0.91
50_V	54_F	1.805	0.90
1_M	15_P	1.579	0.83
56_E	59_Q	1.577	0.83
6_F	20_T	1.556	0.82
33_V	37_L	1.510	0.80
42_F	48_T	1.468	0.78
5_V	35_T	1.464	0.77
59_Q	64_F	1.456	0.77
19_K	44_I	1.395	0.74
13_E	16_V	1.366	0.72
19_K	68_E	1.323	0.70
6_F	61_S	1.287	0.68
48_T	54_F	1.270	0.67
30_E	34_R	1.239	0.65
27_G	32_D	1.222	0.63
3_Y	49_P	1.216	0.63
13_E	59_Q	1.213	0.63
24_Y	50_V	1.201	0.62
36_K	67_L	1.180	0.61
6_F	48_T	1.134	0.58
10_K	54_F	1.120	0.57
16_V	40_K	1.119	0.57
37_L	68_E	1.117	0.56
27_G	66_V	1.091	0.55
16_V	19_K	1.076	0.54
6_F	51_D	1.044	0.51
32_D	36_K	1.043	0.51
27_G	48_T	1.016	0.49
29_S	49_P	1.014	0.49
31_R	44_I	1.011	0.49
3_Y	12_D	1.005	0.49
60_Q	65_K	0.954	0.45
49_P	53_A	0.950	0.45
19_K	67_L	0.948	0.45
10_K	28_V	0.945	0.44
50_V	67_L	0.922	0.43
16_V	38_K	0.913	0.42
48_T	51_D	0.909	0.42
22_S	25_I	0.890	0.41
26_E	66_V	0.889	0.41
62_E	65_K	0.883	0.40
6_F	19_K	0.868	0.39
34_R	47_I	0.867	0.39
14_V	48_T	0.853	0.38
30_E	44_I	0.851	0.38
13_E	31_R	0.840	0.37
13_E	37_L	0.839	0.37
12_D	41_K	0.827	0.36
10_K	31_R	0.796	0.34
24_Y	64_F	0.791	0.34
37_L	67_L	0.788	0.34
29_S	51_D	0.782	0.34
23_L	44_I	0.770	0.33
25_I	34_R	0.761	0.32
41_K	53_A	0.751	0.32
6_F	29_S	0.737	0.31
14_V	57_Y	0.732	0.31
21_D	49_P	0.724	0.30
11_A	22_S	0.721	0.30
10_K	51_D	0.721	0.30
33_V	36_K	0.714	0.29
30_E	66_V	0.698	0.29
35_T	43_N	0.697	0.28
26_E	30_E	0.690	0.28
24_Y	44_I	0.672	0.27
39_E	46_F	0.661	0.26
7_Y	22_S	0.652	0.26
39_E	47_I	0.642	0.25
38_K	68_E	0.633	0.25
23_L	48_T	0.628	0.25
2_I	25_I	0.621	0.24
56_E	60_Q	0.613	0.24
25_I	33_V	0.605	0.23
5_V	44_I	0.587	0.23
29_S	32_D	0.586	0.23
24_Y	61_S	0.585	0.23
24_Y	54_F	0.584	0.22
33_V	40_K	0.583	0.22
10_K	19_K	0.582	0.22
53_A	61_S	0.569	0.22
50_V	55_L	0.567	0.22
2_I	12_D	0.564	0.21
23_L	42_F	0.550	0.21
14_V	66_V	0.550	0.21
12_D	43_N	0.528	0.20
9_E	24_Y	0.525	0.20
27_G	33_V	0.524	0.20
62_E	66_V	0.523	0.20
6_F	16_V	0.521	0.20
14_V	67_L	0.518	0.19
3_Y	21_D	0.507	0.19
21_D	41_K	0.505	0.19
33_V	43_N	0.503	0.19
56_E	64_F	0.500	0.19

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4njcA	1	0.8406	99.9	0.215	Contact Map
3voqA	2	0.5942	16.6	0.911	Contact Map
3ulbA	2	0.6522	11.6	0.917	Contact Map
3kuzA	2	0.913	3.7	0.934	Contact Map
4dbbA	1	0.2754	3.1	0.937	Contact Map
3zey4	1	0.5217	3	0.937	Contact Map
4bwzA	2	0.2609	2.1	0.942	Contact Map
4mtsA	2	0.913	2.1	0.942	Contact Map
2dkaA	1	0.5652	2.1	0.943	Contact Map
4nicA	2	0.7246	1.9	0.944	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0045 seconds.