MOBB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

MOBB - Probable molybdopterin-guanine dinucleotide biosynthesis adapter protein

UniProt:	O31704	Sequences: MALVRPFPIVQVVGFQNSGKTTFIERILEKASEQGVHLGCLKHHGHGGEPQTLTEGKDTDRYKAAGADVTAVEGAGVLQLTARRNWDLARLIELYQFLETDCLLIEGFKKAPYPKVVILSEKEDLEALQAVNIIAIIYRKKEHMTEHQGLPVFHADDPVAVDFVLSQLKGESA	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	173 (154)
Sequences:	1377 (1035)
Seq/√Len:	83.4

ECOLI - MOBB
BACSU - MOBB
HALSA - Q9HR77
SULSO - Q7LXN5

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
25_E	61_R	5.488	1.00
40_C	62_Y	3.808	1.00
16_Q	57_K	3.411	1.00
157_D	160_A	3.157	1.00
32_S	68_D	3.102	1.00
34_Q	162_D	2.892	1.00
39_G	100_T	2.795	1.00
135_A	139_R	2.787	1.00
133_I	139_R	2.778	1.00
77_V	83_R	2.704	1.00
14_G	18_S	2.364	1.00
136_I	139_R	2.283	1.00
39_G	95_Y	2.193	1.00
63_K	83_R	2.155	1.00
135_A	138_Y	2.155	1.00
50_P	81_T	2.137	1.00
30_K	159_V	2.129	1.00
30_K	34_Q	2.126	1.00
133_I	138_Y	1.963	1.00
11_Q	113_Y	1.940	1.00
24_I	62_Y	1.916	1.00
60_D	64_A	1.913	1.00
28_L	40_C	1.851	1.00
34_Q	165_L	1.793	1.00
9_I	92_I	1.699	1.00
36_V	165_L	1.673	1.00
44_H	48_G	1.652	1.00
69_V	82_A	1.612	1.00
134_I	139_R	1.566	1.00
30_K	158_P	1.559	1.00
134_I	138_Y	1.554	1.00
48_G	74_G	1.552	1.00
105_I	113_Y	1.502	0.99
27_I	161_V	1.498	0.99
133_I	136_I	1.479	0.99
11_Q	105_I	1.457	0.99
87_D	90_R	1.453	0.99
71_A	80_L	1.383	0.99
137_I	140_K	1.383	0.99
47_G	76_G	1.375	0.99
23_F	161_V	1.370	0.99
153_F	163_F	1.357	0.99
7_F	103_L	1.319	0.99
59_T	72_V	1.315	0.99
22_T	158_P	1.311	0.98
133_I	137_I	1.310	0.98
48_G	72_V	1.275	0.98
51_Q	56_G	1.250	0.98
133_I	140_K	1.240	0.98
30_K	33_E	1.237	0.98
24_I	29_E	1.235	0.98
151_P	163_F	1.200	0.97
108_F	111_A	1.173	0.97
41_L	103_L	1.145	0.96
109_K	115_K	1.137	0.96
48_G	81_T	1.136	0.96
136_I	140_K	1.117	0.96
120_S	155_A	1.106	0.96
41_L	88_L	1.094	0.95
18_S	118_I	1.093	0.95
92_I	103_L	1.070	0.95
17_N	57_K	1.068	0.95
69_V	96_Q	1.067	0.95
73_E	91_L	1.065	0.95
51_Q	60_D	1.049	0.94
48_G	79_Q	1.048	0.94
78_L	82_A	1.045	0.94
12_V	27_I	1.040	0.94
71_A	91_L	1.037	0.94
24_I	104_L	1.030	0.94
117_V	129_Q	1.024	0.93
30_K	162_D	1.020	0.93
159_V	162_D	1.011	0.93
134_I	140_K	0.998	0.92
40_C	67_A	0.998	0.92
10_V	167_Q	0.995	0.92
36_V	102_C	0.990	0.92
154_H	157_D	0.976	0.92
116_V	135_A	0.967	0.91
72_V	79_Q	0.959	0.91
50_P	79_Q	0.948	0.90
25_E	64_A	0.942	0.90
132_N	135_A	0.938	0.90
75_A	85_N	0.937	0.90
14_G	70_T	0.925	0.89
31_A	165_L	0.923	0.89
10_V	104_L	0.922	0.89
10_V	116_V	0.917	0.89
9_I	103_L	0.912	0.89
12_V	116_V	0.905	0.88
90_R	93_E	0.892	0.88
119_L	127_A	0.890	0.87
148_Q	151_P	0.888	0.87
48_G	51_Q	0.874	0.86
15_F	109_K	0.870	0.86
24_I	28_L	0.866	0.86
31_A	104_L	0.860	0.86
132_N	136_I	0.860	0.86
132_N	139_R	0.858	0.85
25_E	65_A	0.848	0.85
9_I	113_Y	0.839	0.84
153_F	161_V	0.832	0.84
26_R	158_P	0.822	0.83
158_P	161_V	0.816	0.82
56_G	60_D	0.812	0.82
95_Y	100_T	0.807	0.82
117_V	130_A	0.805	0.82
148_Q	152_V	0.800	0.81
44_H	74_G	0.795	0.81
27_I	31_A	0.790	0.80
82_A	96_Q	0.786	0.80
153_F	158_P	0.782	0.80
154_H	160_A	0.780	0.80
63_K	77_V	0.780	0.80
10_V	164_V	0.779	0.79
38_L	102_C	0.775	0.79
39_G	62_Y	0.774	0.79
69_V	94_L	0.766	0.78
87_D	111_A	0.762	0.78
147_H	151_P	0.760	0.78
132_N	140_K	0.755	0.77
44_H	62_Y	0.745	0.76
44_H	49_E	0.736	0.75
8_P	102_C	0.722	0.74
49_E	77_V	0.722	0.74
59_T	62_Y	0.720	0.74
43_H	74_G	0.720	0.74
91_L	108_F	0.717	0.74
45_G	73_E	0.710	0.73
73_E	85_N	0.710	0.73
162_D	166_S	0.704	0.72
89_A	111_A	0.704	0.72
135_A	140_K	0.703	0.72
14_G	62_Y	0.701	0.72
45_G	59_T	0.693	0.71
11_Q	45_G	0.692	0.71
72_V	77_V	0.689	0.71
51_Q	55_E	0.689	0.71
43_H	115_K	0.687	0.70
14_G	107_G	0.682	0.70
36_V	101_D	0.674	0.69
71_A	86_W	0.672	0.69
88_L	111_A	0.668	0.68
14_G	118_I	0.667	0.68
29_E	32_S	0.662	0.68
47_G	75_A	0.656	0.67
84_R	90_R	0.650	0.66
26_R	156_D	0.650	0.66
149_G	152_V	0.648	0.66
44_H	72_V	0.646	0.66
96_Q	99_E	0.643	0.65
71_A	95_Y	0.639	0.65
43_H	109_K	0.636	0.64
153_F	167_Q	0.635	0.64
15_F	115_K	0.634	0.64
164_V	168_L	0.627	0.63
43_H	46_H	0.625	0.63
135_A	153_F	0.622	0.63
147_H	166_S	0.620	0.62
129_Q	149_G	0.616	0.62
39_G	69_V	0.616	0.62
62_Y	65_A	0.613	0.62
43_H	58_D	0.613	0.62
43_H	107_G	0.609	0.61
69_V	80_L	0.606	0.61
11_Q	111_A	0.602	0.60
165_L	168_L	0.601	0.60
22_T	31_A	0.596	0.59
146_E	149_G	0.594	0.59
153_F	156_D	0.592	0.59
41_L	134_I	0.592	0.59
7_F	14_G	0.590	0.59
80_L	94_L	0.587	0.58
95_Y	103_L	0.582	0.58
16_Q	118_I	0.578	0.57
95_Y	99_E	0.576	0.57
28_L	62_Y	0.575	0.57
8_P	18_S	0.575	0.57
44_H	47_G	0.571	0.56
82_A	94_L	0.566	0.56
14_G	19_G	0.564	0.55
10_V	24_I	0.562	0.55
47_G	110_K	0.561	0.55
105_I	108_F	0.556	0.54
44_H	76_G	0.554	0.54
41_L	91_L	0.553	0.54
14_G	20_K	0.553	0.54
85_N	121_E	0.552	0.54
15_F	127_A	0.552	0.54
36_V	92_I	0.551	0.54
22_T	26_R	0.549	0.53
56_G	103_L	0.547	0.53
93_E	166_S	0.547	0.53
29_E	40_C	0.546	0.53
64_A	144_M	0.546	0.53
69_V	99_E	0.545	0.53
61_R	64_A	0.544	0.53
95_Y	126_E	0.544	0.53
75_A	100_T	0.543	0.53
16_Q	24_I	0.542	0.52
69_V	95_Y	0.541	0.52
88_L	128_L	0.539	0.52
58_D	109_K	0.534	0.51
27_I	158_P	0.534	0.51
46_H	137_I	0.534	0.51
117_V	123_E	0.533	0.51
12_V	26_R	0.533	0.51
93_E	122_K	0.531	0.51
50_P	75_A	0.531	0.51
44_H	75_A	0.530	0.51
69_V	100_T	0.528	0.51
37_H	68_D	0.527	0.50
30_K	157_D	0.525	0.50
40_C	113_Y	0.523	0.50
82_A	99_E	0.523	0.50
28_L	70_T	0.521	0.50
31_A	36_V	0.517	0.49
38_L	68_D	0.516	0.49
55_E	64_A	0.515	0.49
119_L	124_D	0.515	0.49
91_L	95_Y	0.514	0.49
156_D	160_A	0.510	0.48
23_F	116_V	0.510	0.48
17_N	24_I	0.509	0.48
132_N	137_I	0.507	0.48
118_I	155_A	0.505	0.48
74_G	77_V	0.504	0.47
93_E	168_L	0.503	0.47
109_K	114_P	0.503	0.47
28_L	102_C	0.501	0.47
117_V	125_L	0.500	0.47

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4nkrA	2	0.9364	100	0.394	Contact Map
1xjcA	2	0.8208	100	0.46	Contact Map
1np6A	2	0.9364	99.7	0.673	Contact Map
2f1rA	2	0.8382	99.5	0.723	Contact Map
4ehxA	1	0.948	99.2	0.762	Contact Map
2wsmA	2	0.896	98.7	0.806	Contact Map
4a0gA	2	0.9017	98.7	0.81	Contact Map
3fgnA	2	0.8613	98.5	0.819	Contact Map
3of5A	2	0.9422	98.4	0.825	Contact Map
3kl4A	1	0.9017	98.4	0.827	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.007 seconds.