YJDG - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YJDG - Uncharacterized N-acetyltransferase YjdG

UniProt:	O31648	Sequences: MVLLETNRLRLQTIDIPLLDAASKQDHQAIKELGYETNGEWPNSDFFEAIPYFREILVKNNGTKGFDSWIIVKKDNYEIVGGTGFLGDPDENGMIEIGFATNKSHRRKGYCVEAAQKLINWALSRETVSRITARCEHDNLGSQKTLEKLGFILNHKSAEYKHWIYVTK	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	168 (150)
Sequences:	19056 (15106)
Seq/√Len:	1233.4

ECOLI - RIMJ RIML ATDA YHHY MNAT
BACSU - YJDG YKKB YOAA YJCK YDAF YOKL YNAD YWNH
HALSA - Q9HMZ2 Q9HNJ3 Q9HRY6 Q9HRY5 Q9HSL3

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
112_V	148_K	2.924	1.00
133_A	146_L	2.917	1.00
12_Q	72_V	2.902	1.00
73_K	76_N	2.589	1.00
12_Q	18_L	2.477	1.00
135_C	143_Q	2.401	1.00
5_E	74_K	2.283	1.00
95_I	128_V	2.252	1.00
31_K	103_K	2.247	1.00
85_F	122_A	2.200	1.00
135_C	146_L	2.152	1.00
153_L	156_K	2.136	1.00
6_T	117_K	2.083	1.00
8_R	113_E	2.048	1.00
144_K	147_E	2.003	1.00
143_Q	147_E	1.956	1.00
14_I	70_I	1.932	1.00
97_I	115_A	1.843	1.00
120_N	124_S	1.839	1.00
70_I	79_I	1.830	1.00
119_I	151_F	1.793	1.00
28_Q	103_K	1.755	1.00
129_S	159_E	1.696	1.00
21_A	79_I	1.681	1.00
119_I	131_I	1.673	1.00
102_N	105_H	1.650	1.00
72_V	77_Y	1.648	1.00
10_R	74_K	1.640	1.00
6_T	113_E	1.637	1.00
143_Q	153_L	1.627	1.00
83_T	114_A	1.614	1.00
115_A	149_L	1.612	1.00
117_K	120_N	1.558	1.00
101_T	111_C	1.549	1.00
99_F	146_L	1.446	1.00
140_L	143_Q	1.443	1.00
71_I	101_T	1.417	1.00
147_E	153_L	1.400	1.00
49_A	53_F	1.357	1.00
99_F	142_S	1.330	1.00
71_I	114_A	1.323	1.00
137_H	156_K	1.315	1.00
112_V	145_T	1.297	1.00
73_K	80_V	1.284	1.00
42_P	45_D	1.275	1.00
130_R	154_N	1.269	1.00
21_A	78_E	1.226	1.00
5_E	10_R	1.220	1.00
32_E	106_R	1.215	1.00
10_R	72_V	1.214	1.00
83_T	118_L	1.199	1.00
121_W	125_R	1.194	1.00
80_V	105_H	1.184	1.00
16_I	54_R	1.183	1.00
82_G	100_A	1.162	1.00
73_K	110_Y	1.156	1.00
122_A	131_I	1.150	1.00
78_E	104_S	1.143	1.00
111_C	145_T	1.129	1.00
94_M	132_T	1.129	1.00
50_I	53_F	1.124	1.00
122_A	126_E	1.123	1.00
46_F	50_I	1.121	1.00
25_Q	100_A	1.120	1.00
133_A	151_F	1.118	1.00
121_W	126_E	1.117	1.00
6_T	9_L	1.108	1.00
33_L	36_E	1.107	1.00
50_I	54_R	1.107	1.00
78_E	105_H	1.095	1.00
96_E	134_R	1.092	1.00
69_W	118_L	1.080	1.00
20_D	43_N	1.065	1.00
52_Y	56_I	1.056	1.00
145_T	149_L	1.046	1.00
21_A	24_K	1.046	1.00
25_Q	102_N	1.042	1.00
73_K	108_K	1.039	1.00
142_S	146_L	1.030	1.00
146_L	151_F	1.029	1.00
106_R	141_G	1.013	1.00
28_Q	31_K	1.010	1.00
19_L	50_I	0.995	1.00
112_V	116_Q	0.993	1.00
45_D	48_E	0.991	1.00
19_L	47_F	0.984	1.00
69_W	121_W	0.979	1.00
73_K	78_E	0.978	1.00
103_K	106_R	0.971	1.00
154_N	158_A	0.971	1.00
14_I	82_G	0.969	1.00
31_K	34_G	0.968	1.00
28_Q	102_N	0.959	1.00
28_Q	104_S	0.958	1.00
43_N	47_F	0.921	1.00
26_D	100_A	0.916	1.00
23_S	27_H	0.906	1.00
122_A	128_V	0.900	1.00
72_V	79_I	0.893	1.00
89_P	92_N	0.891	1.00
51_P	55_E	0.886	1.00
116_Q	120_N	0.885	1.00
140_L	144_K	0.884	1.00
10_R	77_Y	0.880	1.00
107_R	141_G	0.875	1.00
85_F	118_L	0.872	1.00
119_I	149_L	0.870	1.00
112_V	149_L	0.870	1.00
9_L	114_A	0.866	1.00
9_L	110_Y	0.857	1.00
116_Q	149_L	0.849	1.00
19_L	23_S	0.843	1.00
47_F	50_I	0.840	1.00
18_L	72_V	0.838	1.00
99_F	111_C	0.838	1.00
113_E	117_K	0.833	1.00
101_T	110_Y	0.832	1.00
140_L	147_E	0.831	1.00
24_K	102_N	0.830	1.00
94_M	130_R	0.830	1.00
44_S	48_E	0.821	1.00
24_K	104_S	0.815	1.00
46_F	49_A	0.807	1.00
35_Y	138_D	0.803	1.00
24_K	28_Q	0.803	1.00
51_P	54_R	0.797	1.00
134_R	157_S	0.797	1.00
71_I	83_T	0.791	1.00
105_H	108_K	0.786	1.00
78_E	102_N	0.778	1.00
21_A	102_N	0.777	1.00
20_D	24_K	0.773	1.00
73_K	105_H	0.770	1.00
6_T	11_L	0.764	1.00
47_F	51_P	0.761	1.00
24_K	78_E	0.746	1.00
12_Q	70_I	0.744	1.00
35_Y	136_E	0.743	1.00
115_A	145_T	0.740	1.00
135_C	142_S	0.733	1.00
16_I	19_L	0.721	1.00
37_T	40_E	0.718	1.00
112_V	141_G	0.715	1.00
44_S	47_F	0.700	1.00
107_R	144_K	0.700	1.00
49_A	52_Y	0.699	1.00
23_S	43_N	0.696	1.00
96_E	132_T	0.689	1.00
133_A	142_S	0.688	1.00
71_I	110_Y	0.685	1.00
48_E	52_Y	0.684	1.00
71_I	81_G	0.684	1.00
107_R	112_V	0.681	1.00
68_S	84_G	0.681	1.00
48_E	51_P	0.674	1.00
40_E	46_F	0.669	1.00
26_D	82_G	0.652	1.00
7_N	113_E	0.652	1.00
43_N	49_A	0.650	1.00
41_W	45_D	0.645	1.00
99_F	115_A	0.642	1.00
80_V	110_Y	0.642	1.00
101_T	106_R	0.641	1.00
111_C	115_A	0.639	1.00
16_I	51_P	0.638	1.00
137_H	143_Q	0.633	1.00
8_R	109_G	0.633	1.00
144_K	148_K	0.633	1.00
20_D	46_F	0.630	1.00
141_G	144_K	0.629	1.00
32_E	36_E	0.628	1.00
13_T	61_N	0.626	1.00
16_I	50_I	0.625	1.00
93_G	129_S	0.625	1.00
40_E	43_N	0.624	1.00
32_E	35_Y	0.617	1.00
61_N	67_D	0.617	1.00
110_Y	113_E	0.608	1.00
86_L	96_E	0.608	1.00
101_T	105_H	0.603	1.00
52_Y	55_E	0.600	1.00
152_I	158_A	0.598	1.00
38_N	41_W	0.594	1.00
132_T	157_S	0.593	1.00
119_I	123_L	0.587	1.00
71_I	111_C	0.586	1.00
99_F	145_T	0.583	1.00
12_Q	15_D	0.580	1.00
25_Q	79_I	0.579	1.00
83_T	115_A	0.577	1.00
107_R	145_T	0.576	1.00
55_E	63_T	0.567	1.00
85_F	95_I	0.565	1.00
79_I	82_G	0.562	1.00
95_I	131_I	0.561	1.00
15_D	18_L	0.560	1.00
97_I	131_I	0.553	1.00
36_E	100_A	0.553	1.00
21_A	72_V	0.553	1.00
31_K	106_R	0.550	1.00
43_N	46_F	0.548	1.00
20_D	23_S	0.546	1.00
9_L	113_E	0.541	1.00
131_I	151_F	0.536	1.00
7_N	10_R	0.535	1.00
45_D	50_I	0.533	1.00
22_A	26_D	0.532	1.00
154_N	157_S	0.530	1.00
143_Q	146_L	0.525	1.00
99_F	133_A	0.523	1.00
29_A	32_E	0.521	1.00
95_I	122_A	0.518	1.00
74_K	113_E	0.516	1.00
29_A	103_K	0.515	1.00
53_F	56_I	0.514	1.00
120_N	125_R	0.514	1.00
29_A	34_G	0.514	1.00
68_S	100_A	0.512	1.00
94_M	157_S	0.508	1.00
115_A	151_F	0.508	1.00
22_A	82_G	0.505	1.00
101_T	114_A	0.505	1.00
98_G	142_S	0.501	1.00
19_L	43_N	0.500	1.00
155_H	158_A	0.500	1.00

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2fckA	2	0.9524	99.9	0.322	Contact Map
2vzyA	3	0.8869	99.9	0.328	Contact Map
3pzjA	2	0.9583	99.9	0.331	Contact Map
3r9fA	1	0.9762	99.9	0.334	Contact Map
1yreA	2	0.9167	99.9	0.34	Contact Map
1s7kA	2	0.8571	99.9	0.343	Contact Map
1nslA	3	0.9643	99.9	0.349	Contact Map
3fbuA	2	0.9286	99.9	0.359	Contact Map
3igrA	2	0.994	99.9	0.362	Contact Map
2z10A	2	0.9345	99.9	0.364	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0074 seconds.