YJCG - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YJCG - UPF0477 protein YjcG

UniProt:	O31629	Sequences: MKYGIVLFPSKKLQDLANSYRKRYDPSYSLIPPHLTLRASFECAEEKADQLVSHLRNIAKESHPLVLKMTKYSSFAPVNNVIYIKAEPTEELKTLNEKLYTGVLAGEQEYNFVPHVTVGQNLSDDEHSDVLGQLKMQEVSHEEIVDRFHLLYQLENGSWTVYETFLLGRGE	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	171 (163)
Sequences:	750 (554)
Seq/√Len:	43.4

ECOLI - LIGT
BACSU - YJCG YTLP
SULSO - Q97Z91

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
35_L	67_L	7.424	1.00
7_L	145_V	4.056	1.00
62_S	98_K	3.615	1.00
43_C	51_L	3.094	1.00
7_L	65_L	2.861	1.00
59_A	148_F	2.858	1.00
68_K	142_E	2.360	1.00
10_S	143_E	2.278	1.00
13_L	141_H	2.260	1.00
53_S	57_N	2.095	0.99
54_H	102_G	2.043	0.99
72_Y	134_L	2.009	0.99
68_K	140_S	1.988	0.99
73_S	85_K	1.973	0.99
16_L	139_V	1.911	0.99
80_N	124_D	1.903	0.99
32_P	40_S	1.872	0.99
11_K	15_D	1.805	0.98
52_V	163_E	1.774	0.98
53_S	56_R	1.663	0.97
51_L	104_L	1.653	0.97
66_V	142_E	1.640	0.97
89_T	93_K	1.582	0.96
66_V	144_I	1.538	0.95
153_Q	159_W	1.535	0.95
40_S	159_W	1.514	0.95
16_L	141_H	1.513	0.95
57_N	60_K	1.512	0.95
90_E	93_K	1.509	0.95
56_R	163_E	1.499	0.95
26_P	121_N	1.491	0.95
82_I	122_L	1.473	0.94
84_I	118_V	1.432	0.93
73_S	83_Y	1.426	0.93
24_Y	133_Q	1.409	0.93
6_V	151_L	1.403	0.93
69_M	84_I	1.394	0.92
147_R	164_T	1.376	0.92
156_N	160_T	1.370	0.92
7_L	148_F	1.367	0.92
65_L	145_V	1.367	0.92
79_N	110_Y	1.357	0.91
41_F	159_W	1.357	0.91
3_Y	81_V	1.340	0.91
21_R	25_D	1.333	0.91
28_Y	120_Q	1.326	0.90
80_N	110_Y	1.308	0.90
96_N	100_Y	1.305	0.90
4_G	21_R	1.280	0.89
147_R	167_L	1.279	0.89
72_Y	84_I	1.279	0.89
150_L	165_F	1.270	0.88
61_E	101_T	1.263	0.88
61_E	98_K	1.259	0.88
75_F	81_V	1.249	0.87
145_V	167_L	1.245	0.87
61_E	167_L	1.241	0.87
39_A	111_N	1.229	0.87
54_H	103_V	1.217	0.86
55_L	148_F	1.212	0.86
148_F	167_L	1.210	0.86
44_A	47_K	1.203	0.85
69_M	143_E	1.202	0.85
4_G	120_Q	1.181	0.84
6_V	153_Q	1.169	0.84
63_H	168_G	1.158	0.83
32_P	159_W	1.147	0.83
17_A	151_L	1.125	0.81
93_K	131_L	1.118	0.81
71_K	130_V	1.114	0.81
89_T	131_L	1.114	0.81
61_E	168_G	1.110	0.80
24_Y	118_V	1.083	0.79
12_K	19_S	1.078	0.78
68_K	87_E	1.065	0.78
17_A	84_I	1.065	0.78
56_R	98_K	1.064	0.78
22_K	26_P	1.056	0.77
9_P	28_Y	1.052	0.77
4_G	81_V	1.024	0.75
94_T	98_K	1.022	0.75
8_F	151_L	1.010	0.74
69_M	119_G	0.996	0.73
98_K	167_L	0.994	0.73
93_K	97_E	0.992	0.72
106_G	109_E	0.977	0.71
14_Q	18_N	0.976	0.71
39_A	159_W	0.956	0.70
47_K	97_E	0.936	0.68
39_A	83_Y	0.933	0.68
36_T	115_H	0.932	0.68
121_N	159_W	0.918	0.66
14_Q	17_A	0.904	0.65
6_V	121_N	0.900	0.65
9_P	151_L	0.883	0.63
21_R	38_R	0.883	0.63
32_P	158_S	0.881	0.63
125_D	128_S	0.879	0.63
90_E	107_E	0.877	0.63
71_K	120_Q	0.877	0.63
92_L	112_F	0.873	0.62
32_P	156_N	0.864	0.62
4_G	31_I	0.855	0.61
61_E	132_G	0.852	0.61
121_N	153_Q	0.848	0.60
90_E	167_L	0.840	0.59
86_A	119_G	0.838	0.59
118_V	139_V	0.838	0.59
70_T	140_S	0.838	0.59
21_R	31_I	0.828	0.58
32_P	79_N	0.824	0.58
25_D	31_I	0.823	0.58
119_G	130_V	0.820	0.58
4_G	25_D	0.818	0.57
38_R	100_Y	0.815	0.57
42_E	165_F	0.815	0.57
103_V	107_E	0.814	0.57
63_H	90_E	0.813	0.57
38_R	41_F	0.812	0.57
7_L	168_G	0.807	0.56
35_L	49_D	0.806	0.56
22_K	29_S	0.796	0.55
83_Y	144_I	0.795	0.55
5_I	150_L	0.794	0.55
106_G	167_L	0.793	0.55
58_I	104_L	0.787	0.54
154_L	160_T	0.781	0.54
18_N	31_I	0.778	0.54
3_Y	31_I	0.775	0.53
75_F	159_W	0.773	0.53
163_E	166_L	0.772	0.53
76_A	119_G	0.770	0.53
46_E	60_K	0.769	0.53
16_L	20_Y	0.764	0.52
7_L	99_L	0.760	0.52
143_E	153_Q	0.756	0.52
33_P	99_L	0.754	0.51
83_Y	159_W	0.753	0.51
47_K	50_Q	0.750	0.51
68_K	93_K	0.748	0.51
55_L	59_A	0.738	0.50
59_A	62_S	0.733	0.49
3_Y	43_C	0.727	0.49
40_S	43_C	0.724	0.48
52_V	150_L	0.723	0.48
17_A	92_L	0.722	0.48
74_S	131_L	0.720	0.48
13_L	16_L	0.718	0.48
4_G	80_N	0.714	0.48
162_Y	166_L	0.711	0.47
23_R	33_P	0.711	0.47
16_L	98_K	0.707	0.47
47_K	106_G	0.700	0.46
14_Q	28_Y	0.695	0.46
55_L	99_L	0.693	0.46
34_H	115_H	0.692	0.45
152_Y	162_Y	0.684	0.45
16_L	67_L	0.683	0.45
67_L	130_V	0.682	0.44
63_H	97_E	0.680	0.44
29_S	138_E	0.679	0.44
40_S	79_N	0.676	0.44
76_A	80_N	0.674	0.44
29_S	83_Y	0.669	0.43
18_N	21_R	0.669	0.43
37_L	101_T	0.666	0.43
98_K	142_E	0.666	0.43
54_H	120_Q	0.666	0.43
17_A	116_V	0.666	0.43
15_D	164_T	0.660	0.42
126_E	129_D	0.652	0.42
72_Y	118_V	0.651	0.42
65_L	114_P	0.650	0.41
134_L	152_Y	0.649	0.41
111_N	168_G	0.641	0.41
4_G	36_T	0.641	0.41
64_P	161_V	0.641	0.41
37_L	112_F	0.641	0.41
32_P	39_A	0.638	0.40
31_I	159_W	0.637	0.40
127_H	149_H	0.629	0.40
56_R	97_E	0.629	0.40
30_L	33_P	0.625	0.39
13_L	127_H	0.623	0.39
4_G	110_Y	0.623	0.39
9_P	122_L	0.620	0.39
69_M	116_V	0.618	0.39
87_E	167_L	0.615	0.38
53_S	105_A	0.615	0.38
38_R	69_M	0.610	0.38
9_P	41_F	0.609	0.38
5_I	50_Q	0.609	0.38
21_R	33_P	0.608	0.38
36_T	75_F	0.607	0.38
38_R	99_L	0.603	0.37
39_A	69_M	0.603	0.37
39_A	79_N	0.601	0.37
17_A	152_Y	0.599	0.37
16_L	19_S	0.598	0.37
53_S	98_K	0.596	0.37
57_N	94_T	0.593	0.36
48_A	165_F	0.588	0.36
24_Y	161_V	0.586	0.36
155_E	166_L	0.586	0.36
26_P	85_K	0.582	0.35
34_H	117_T	0.580	0.35
37_L	65_L	0.580	0.35
32_P	157_G	0.575	0.35
68_K	141_H	0.574	0.35
96_N	127_H	0.573	0.35
21_R	26_P	0.570	0.34
13_L	118_V	0.567	0.34
68_K	89_T	0.565	0.34
9_P	14_Q	0.565	0.34
54_H	104_L	0.564	0.34
49_D	57_N	0.562	0.34
6_V	48_A	0.560	0.33
17_A	37_L	0.556	0.33
58_I	99_L	0.555	0.33
84_I	167_L	0.554	0.33
76_A	128_S	0.554	0.33
13_L	88_P	0.552	0.33
4_G	41_F	0.550	0.33
3_Y	121_N	0.548	0.32
6_V	149_H	0.545	0.32
20_Y	167_L	0.542	0.32
37_L	148_F	0.536	0.31
16_L	105_A	0.536	0.31
36_T	71_K	0.535	0.31
65_L	69_M	0.533	0.31
154_L	158_S	0.531	0.31
28_Y	159_W	0.531	0.31
62_S	167_L	0.530	0.31
24_Y	31_I	0.528	0.31
49_D	60_K	0.526	0.31
13_L	160_T	0.525	0.31
70_T	144_I	0.516	0.30
67_L	145_V	0.513	0.30
6_V	75_F	0.512	0.30
66_V	90_E	0.510	0.29
79_N	103_V	0.507	0.29
44_A	111_N	0.503	0.29
53_S	168_G	0.501	0.29
122_L	159_W	0.500	0.29

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2d4gA	2	0.9825	100	0.303	Contact Map
1vgjA	1	0.9766	100	0.378	Contact Map
1iuhA	1	0.9591	100	0.393	Contact Map
1jh6A	5	0.9649	100	0.399	Contact Map
4qakA	1	0.9357	100	0.419	Contact Map
3j4qA	1	0.9825	100	0.422	Contact Map
2vfkA	1	0.9825	100	0.435	Contact Map
4h7wA	1	0.9474	99.9	0.482	Contact Map
2fsqA	1	0.9357	95.9	0.868	Contact Map
4rptA	2	0.807	89	0.897	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0065 seconds.