PRPE - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

PRPE - Bis(5'-nucleosyl)-tetraphosphatase PrpE [asymmetrical]

UniProt:	O31614	Sequences: MAYDIISDIHGCYDEMTALIQKLGYTIKNGVPVHEEGRVLVFAGDLTDRGPKSIEVIRFVAGAYEKGAVRYVPGNHCNKLYRYLKGNPVKVMHGLETTAAELEELSKDEKKSVSEQFMKLYETAPLYDILHNGELVVAHAGIRADDIGKYTRRVKDFVLYGDVTGETYPDGRPIRRDWAAAYNGKAWVVYGHTPVKEPRKVNRTINIDTGCVFGNQLTGFRFPEIETVSVPSSLPYDESRFRPI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	244 (197)
Sequences:	4271 (3178)
Seq/√Len:	226.4

ECOLI - PRP1 PRP2 APAH
BACSU - PRPE

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
52_K	55_E	5.728	1.00
209_T	218_T	3.679	1.00
17_T	59_F	3.093	1.00
14_D	52_K	2.964	1.00
13_Y	55_E	2.931	1.00
13_Y	17_T	2.926	1.00
39_V	70_R	2.750	1.00
73_P	78_N	2.579	1.00
42_F	60_V	2.395	1.00
13_Y	59_F	2.378	1.00
5_I	137_V	2.366	1.00
221_R	224_E	2.349	1.00
9_I	56_V	2.315	1.00
70_R	128_D	2.313	1.00
23_L	219_G	2.287	1.00
41_V	137_V	2.232	1.00
16_M	42_F	2.190	1.00
43_A	137_V	2.142	1.00
19_L	219_G	2.110	1.00
85_K	122_E	2.097	1.00
61_A	117_F	2.018	1.00
78_N	82_R	1.957	1.00
135_L	222_F	1.943	1.00
4_D	221_R	1.935	1.00
12_C	212_V	1.862	1.00
190_Y	204_T	1.813	1.00
187_W	205_I	1.796	1.00
58_R	117_F	1.777	1.00
190_Y	206_N	1.769	1.00
4_D	23_L	1.745	1.00
189_V	207_I	1.744	1.00
63_A	69_V	1.738	1.00
9_I	16_M	1.735	1.00
61_A	120_L	1.689	1.00
12_C	15_E	1.684	1.00
25_Y	38_R	1.675	1.00
148_G	151_T	1.671	1.00
115_E	119_K	1.670	1.00
207_I	220_F	1.594	1.00
205_I	220_F	1.586	1.00
46_L	56_V	1.549	1.00
16_M	59_F	1.529	1.00
41_V	128_D	1.506	1.00
61_A	116_Q	1.490	1.00
5_I	189_V	1.480	1.00
147_I	150_Y	1.479	1.00
46_L	71_Y	1.460	1.00
20_I	59_F	1.439	1.00
40_L	63_A	1.427	1.00
46_L	60_V	1.420	1.00
47_T	77_C	1.417	1.00
189_V	220_F	1.406	1.00
71_Y	124_A	1.396	1.00
102_L	117_F	1.376	1.00
54_I	58_R	1.375	1.00
138_A	188_V	1.364	1.00
127_Y	136_V	1.352	1.00
221_R	228_V	1.346	1.00
16_M	56_V	1.322	1.00
54_I	101_E	1.318	1.00
120_L	124_A	1.294	1.00
57_I	121_Y	1.292	1.00
15_E	211_C	1.281	1.00
26_T	36_E	1.271	1.00
187_W	225_I	1.267	1.00
12_C	211_C	1.262	1.00
42_F	71_Y	1.259	1.00
73_P	81_Y	1.252	1.00
43_A	72_V	1.249	1.00
195_V	198_P	1.233	1.00
135_L	187_W	1.224	1.00
42_F	69_V	1.197	1.00
98_T	102_L	1.169	1.00
194_P	212_V	1.148	1.00
48_D	98_T	1.148	1.00
46_L	72_V	1.136	1.00
125_P	128_D	1.133	1.00
84_L	118_M	1.116	1.00
174_I	178_W	1.102	1.00
3_Y	39_V	1.075	1.00
131_H	186_A	1.053	1.00
59_F	63_A	1.051	1.00
90_K	94_G	1.041	1.00
62_G	66_K	1.029	1.00
5_I	135_L	1.023	1.00
194_P	213_F	1.020	1.00
79_K	93_H	1.018	1.00
118_M	122_E	1.016	1.00
168_Y	172_R	1.002	1.00
129_I	186_A	0.998	1.00
20_I	42_F	0.997	1.00
98_T	101_E	0.988	1.00
95_L	98_T	0.979	1.00
136_V	188_V	0.979	1.00
58_R	116_Q	0.975	1.00
73_P	124_A	0.968	1.00
100_A	104_E	0.960	1.00
96_E	100_A	0.960	1.00
216_Q	229_S	0.959	1.00
43_A	207_I	0.954	1.00
39_V	68_A	0.951	1.00
9_I	42_F	0.945	1.00
176_R	180_A	0.943	1.00
25_Y	35_E	0.943	1.00
134_E	186_A	0.939	1.00
13_Y	52_K	0.933	1.00
15_E	214_G	0.931	1.00
57_I	117_F	0.927	1.00
212_V	215_N	0.921	1.00
48_D	76_H	0.918	1.00
47_T	57_I	0.917	1.00
210_G	213_F	0.916	1.00
7_S	218_T	0.912	0.99
59_F	62_G	0.911	0.99
224_E	228_V	0.911	0.99
81_Y	121_Y	0.908	0.99
18_A	21_Q	0.906	0.99
58_R	105_L	0.901	0.99
60_V	71_Y	0.899	0.99
7_S	207_I	0.897	0.99
221_R	226_E	0.896	0.99
119_K	123_T	0.895	0.99
58_R	61_A	0.893	0.99
135_L	189_V	0.882	0.99
170_D	174_I	0.877	0.99
42_F	46_L	0.874	0.99
175_R	193_T	0.868	0.99
7_S	42_F	0.868	0.99
94_G	98_T	0.861	0.99
174_I	179_A	0.859	0.99
7_S	209_T	0.858	0.99
147_I	151_T	0.853	0.99
136_V	186_A	0.847	0.99
5_I	222_F	0.844	0.99
40_L	69_V	0.841	0.99
35_E	38_R	0.836	0.99
77_C	81_Y	0.835	0.99
11_G	53_S	0.835	0.99
3_Y	137_V	0.835	0.99
184_G	203_R	0.817	0.99
13_Y	56_V	0.806	0.99
143_R	146_D	0.806	0.99
194_P	206_N	0.805	0.99
195_V	206_N	0.805	0.99
6_I	219_G	0.803	0.99
143_R	170_D	0.800	0.99
189_V	205_I	0.797	0.99
4_D	228_V	0.792	0.99
60_V	69_V	0.789	0.99
73_P	168_Y	0.787	0.98
171_G	174_I	0.786	0.98
220_F	225_I	0.778	0.98
169_P	172_R	0.776	0.98
130_L	133_G	0.771	0.98
80_L	90_K	0.769	0.98
114_S	117_F	0.768	0.98
71_Y	120_L	0.765	0.98
26_T	37_G	0.764	0.98
78_N	172_R	0.764	0.98
10_H	212_V	0.763	0.98
47_T	80_L	0.755	0.98
129_I	136_V	0.752	0.98
90_K	95_L	0.751	0.98
141_G	174_I	0.750	0.98
211_C	217_L	0.749	0.98
194_P	210_G	0.749	0.98
18_A	22_K	0.747	0.98
90_K	93_H	0.742	0.98
4_D	219_G	0.741	0.98
146_D	151_T	0.737	0.98
127_Y	151_T	0.735	0.98
57_I	102_L	0.724	0.97
133_G	186_A	0.722	0.97
89_V	93_H	0.720	0.97
55_E	58_R	0.717	0.97
3_Y	130_L	0.714	0.97
72_V	137_V	0.713	0.97
57_I	61_A	0.713	0.97
177_D	180_A	0.709	0.97
81_Y	122_E	0.708	0.97
4_D	38_R	0.707	0.97
4_D	25_Y	0.704	0.97
41_V	70_R	0.703	0.97
223_P	226_E	0.703	0.97
73_P	126_L	0.702	0.97
17_T	55_E	0.702	0.97
19_L	217_L	0.700	0.97
178_W	188_V	0.693	0.97
58_R	113_V	0.690	0.97
3_Y	223_P	0.690	0.97
127_Y	152_R	0.689	0.97
20_I	25_Y	0.682	0.96
135_L	205_I	0.682	0.96
70_R	125_P	0.671	0.96
197_E	216_Q	0.668	0.96
71_Y	125_P	0.667	0.96
20_I	40_L	0.665	0.96
19_L	23_L	0.664	0.96
187_W	203_R	0.663	0.96
70_R	124_A	0.662	0.96
22_K	228_V	0.662	0.96
39_V	132_N	0.659	0.96
172_R	175_R	0.659	0.96
17_T	21_Q	0.651	0.95
91_V	94_G	0.649	0.95
80_L	121_Y	0.641	0.95
58_R	107_K	0.640	0.95
121_Y	124_A	0.639	0.95
56_V	59_F	0.637	0.95
21_Q	122_E	0.637	0.95
220_F	227_T	0.636	0.95
38_R	221_R	0.634	0.94
218_T	227_T	0.633	0.94
77_C	121_Y	0.632	0.94
6_I	217_L	0.630	0.94
168_Y	171_G	0.628	0.94
200_K	205_I	0.628	0.94
103_E	107_K	0.628	0.94
6_I	42_F	0.628	0.94
89_V	92_M	0.621	0.94
218_T	229_S	0.621	0.94
198_P	218_T	0.619	0.94
95_L	102_L	0.617	0.94
23_L	38_R	0.613	0.93
41_V	130_L	0.613	0.93
73_P	172_R	0.613	0.93
144_A	148_G	0.609	0.93
25_Y	40_L	0.608	0.93
10_H	43_A	0.604	0.93
59_F	69_V	0.603	0.93
132_N	137_V	0.599	0.93
198_P	209_T	0.598	0.93
3_Y	41_V	0.597	0.93
97_T	101_E	0.596	0.92
179_A	182_Y	0.584	0.92
6_I	40_L	0.583	0.92
170_D	173_P	0.583	0.92
146_D	150_Y	0.582	0.92
9_I	60_V	0.579	0.91
174_I	177_D	0.579	0.91
142_I	151_T	0.577	0.91
11_G	49_R	0.567	0.91
63_A	68_A	0.561	0.90
117_F	120_L	0.558	0.90
61_A	66_K	0.558	0.90
116_Q	119_K	0.557	0.90
42_F	219_G	0.556	0.90
70_R	73_P	0.555	0.90
53_S	56_V	0.554	0.90
12_C	214_G	0.553	0.89
189_V	222_F	0.553	0.89
55_E	59_F	0.553	0.89
14_D	18_A	0.552	0.89
46_L	124_A	0.551	0.89
222_F	225_I	0.550	0.89
178_W	182_Y	0.550	0.89
131_H	134_E	0.549	0.89
58_R	62_G	0.549	0.89
142_I	184_G	0.548	0.89
5_I	43_A	0.548	0.89
91_V	95_L	0.546	0.89
45_D	76_H	0.544	0.89
198_P	216_Q	0.542	0.88
48_D	194_P	0.539	0.88
46_L	77_C	0.538	0.88
26_T	38_R	0.538	0.88
15_E	18_A	0.538	0.88
198_P	227_T	0.537	0.88
81_Y	85_K	0.535	0.88
100_A	103_E	0.534	0.88
80_L	113_V	0.531	0.87
197_E	209_T	0.528	0.87
178_W	206_N	0.526	0.87
16_M	69_V	0.524	0.87
7_S	219_G	0.523	0.87
96_E	99_A	0.519	0.86
21_Q	24_G	0.519	0.86
94_G	102_L	0.517	0.86
185_K	203_R	0.516	0.86
47_T	53_S	0.515	0.86
4_D	223_P	0.515	0.86
54_I	117_F	0.515	0.86
8_D	11_G	0.514	0.86
6_I	16_M	0.514	0.86
81_Y	118_M	0.512	0.86
53_S	98_T	0.511	0.85
141_G	188_V	0.509	0.85
127_Y	142_I	0.505	0.85
130_L	135_L	0.505	0.85
211_C	218_T	0.505	0.85
118_M	126_L	0.504	0.85
48_D	193_T	0.503	0.85
72_V	128_D	0.503	0.85
3_Y	132_N	0.503	0.85
14_D	17_T	0.501	0.84
16_M	60_V	0.500	0.84

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4j6oA	1	0.9836	100	0.375	Contact Map
2dfjA	2	0.8689	100	0.376	Contact Map
2qjcA	1	0.832	100	0.401	Contact Map
2z72A	1	0.9713	100	0.464	Contact Map
1g5bA	4	0.8074	100	0.512	Contact Map
3icfA	2	0.8975	100	0.546	Contact Map
4i5lC	1	0.8811	100	0.559	Contact Map
1fjmA	1	0.8648	100	0.564	Contact Map
4il1A	1	0.8934	100	0.566	Contact Map
1auiA	1	0.8934	100	0.572	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0081 seconds.