YJBL - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YJBL - UPF0738 protein YjbL

UniProt:	O31610	Sequences: MQNRIEILNATLSDDQLRLACQTEGNEAERKPSGQMLVDSDHFAFVYILELADSFEYVIIKEHVWPELKQAHAQKIPVVLEAGDQTIELAGLHEELEYLLENIKDNANYGEEMEEKVKRVFL	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	122 (117)
Sequences:	129 (103)
Seq/√Len:	9.5

BACSU - YJBL

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
114_E	118_K	5.935	1.00
38_V	98_Y	2.848	0.89
19_L	64_V	2.713	0.87
37_L	48_I	2.434	0.80
60_I	113_M	2.321	0.77
58_V	80_L	2.111	0.69
105_D	118_K	2.097	0.69
55_F	118_K	1.994	0.65
17_L	60_I	1.964	0.63
71_A	93_H	1.946	0.63
43_F	61_K	1.887	0.60
19_L	60_I	1.886	0.60
10_A	67_E	1.841	0.58
70_Q	94_E	1.841	0.58
6_E	61_K	1.821	0.57
73_A	86_T	1.647	0.50
46_V	54_S	1.630	0.49
37_L	104_K	1.616	0.48
26_N	31_K	1.599	0.47
66_P	100_L	1.570	0.46
50_E	113_M	1.559	0.46
104_K	118_K	1.529	0.44
55_F	114_E	1.453	0.41
49_L	107_A	1.425	0.40
62_E	116_K	1.416	0.39
19_L	78_V	1.414	0.39
78_V	98_Y	1.390	0.38
74_Q	92_L	1.390	0.38
36_M	51_L	1.385	0.38
31_K	44_A	1.382	0.38
27_E	114_E	1.362	0.37
8_L	112_E	1.337	0.36
5_I	54_S	1.321	0.35
38_V	100_L	1.286	0.34
100_L	111_E	1.283	0.34
67_E	120_V	1.283	0.34
60_I	116_K	1.273	0.34
74_Q	84_D	1.265	0.33
37_L	53_D	1.224	0.32
37_L	101_E	1.213	0.31
18_R	107_A	1.213	0.31
44_A	120_V	1.210	0.31
90_A	120_V	1.187	0.30
13_S	33_S	1.181	0.30
69_K	98_Y	1.153	0.29
14_D	20_A	1.152	0.29
80_L	83_G	1.129	0.28
79_V	87_I	1.123	0.28
34_G	54_S	1.109	0.27
4_R	57_Y	1.098	0.27
13_S	79_V	1.097	0.27
85_Q	100_L	1.096	0.27
46_V	99_L	1.089	0.27
48_I	107_A	1.074	0.26
33_S	73_A	1.065	0.26
32_P	84_D	1.045	0.25
35_Q	56_E	1.043	0.25
46_V	59_I	1.042	0.25
66_P	81_E	1.036	0.25
53_D	90_A	1.033	0.25
50_E	107_A	1.032	0.25
16_Q	37_L	1.032	0.25
27_E	82_A	1.029	0.25
8_L	53_D	1.029	0.25
116_K	119_R	1.026	0.25
60_I	64_V	1.019	0.24
4_R	113_M	0.999	0.24
62_E	97_E	0.982	0.23
62_E	119_R	0.979	0.23
30_R	51_L	0.971	0.23
68_L	82_A	0.954	0.22
34_G	58_V	0.951	0.22
70_Q	74_Q	0.947	0.22
13_S	18_R	0.947	0.22
49_L	55_F	0.939	0.22
81_E	87_I	0.932	0.22
7_I	116_K	0.921	0.21
21_C	93_H	0.915	0.21
43_F	59_I	0.913	0.21
30_R	114_E	0.898	0.21
51_L	56_E	0.876	0.20
17_L	120_V	0.867	0.20
80_L	100_L	0.866	0.20
36_M	53_D	0.861	0.19
8_L	113_M	0.840	0.19
14_D	71_A	0.831	0.19
4_R	111_E	0.830	0.19
72_H	97_E	0.826	0.18
48_I	59_I	0.824	0.18
55_F	107_A	0.814	0.18
34_G	68_L	0.809	0.18
10_A	53_D	0.808	0.18
7_I	70_Q	0.800	0.18
6_E	63_H	0.796	0.18
58_V	97_E	0.789	0.18
76_I	79_V	0.781	0.17
22_Q	112_E	0.771	0.17
58_V	83_G	0.768	0.17
55_F	58_V	0.763	0.17
88_E	96_L	0.757	0.17
43_F	113_M	0.750	0.17
38_V	50_E	0.748	0.16
8_L	22_Q	0.746	0.16
31_K	68_L	0.741	0.16
73_A	115_E	0.740	0.16
69_K	78_V	0.736	0.16
34_G	82_A	0.729	0.16
60_I	67_E	0.721	0.16
15_D	33_S	0.721	0.16
20_A	46_V	0.715	0.16
33_S	38_V	0.714	0.16
42_H	54_S	0.714	0.16
36_M	92_L	0.712	0.16
28_A	68_L	0.710	0.16
15_D	49_L	0.706	0.15
22_Q	32_P	0.704	0.15
5_I	21_C	0.703	0.15
49_L	58_V	0.698	0.15
40_S	110_G	0.698	0.15
29_E	83_G	0.694	0.15
20_A	71_A	0.690	0.15
41_D	110_G	0.677	0.15
52_A	113_M	0.674	0.15
70_Q	100_L	0.671	0.15
32_P	91_G	0.670	0.15
55_F	116_K	0.664	0.15
15_D	37_L	0.653	0.14
22_Q	94_E	0.645	0.14
84_D	119_R	0.645	0.14
75_K	119_R	0.644	0.14
22_Q	27_E	0.643	0.14
16_Q	66_P	0.642	0.14
72_H	107_A	0.637	0.14
35_Q	55_F	0.630	0.14
32_P	86_T	0.628	0.14
98_Y	101_E	0.627	0.14
72_H	93_H	0.627	0.14
9_N	120_V	0.620	0.14
36_M	98_Y	0.620	0.14
30_R	118_K	0.611	0.13
45_F	117_V	0.611	0.13
111_E	114_E	0.608	0.13
61_K	87_I	0.602	0.13
5_I	36_M	0.600	0.13
86_T	97_E	0.598	0.13
69_K	73_A	0.593	0.13
35_Q	116_K	0.593	0.13
32_P	55_F	0.592	0.13
74_Q	93_H	0.590	0.13
6_E	23_T	0.581	0.13
68_L	75_K	0.579	0.13
28_A	64_V	0.578	0.13
37_L	49_L	0.574	0.13
62_E	81_E	0.570	0.13
93_H	104_K	0.569	0.13
58_V	85_Q	0.567	0.12
10_A	17_L	0.565	0.12
22_Q	31_K	0.559	0.12
32_P	74_Q	0.552	0.12
5_I	98_Y	0.551	0.12
17_L	88_E	0.550	0.12
81_E	84_D	0.538	0.12
35_Q	94_E	0.533	0.12
32_P	101_E	0.532	0.12
19_L	50_E	0.531	0.12
4_R	105_D	0.526	0.12
26_N	56_E	0.521	0.12
99_L	111_E	0.519	0.12
45_F	103_I	0.518	0.12
57_Y	72_H	0.513	0.11
100_L	120_V	0.509	0.11
51_L	97_E	0.508	0.11
95_E	121_F	0.500	0.11
65_W	95_E	0.500	0.11
65_W	108_N	0.500	0.11
109_Y	121_F	0.500	0.11

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3h43A	5	0.418	8.7	0.949	Contact Map
1txlA	1	0.8033	8.5	0.949	Contact Map
1ye8A	1	0.5082	6.9	0.951	Contact Map
3m63B	1	0.4508	6.1	0.952	Contact Map
1rqbA	2	0.8279	6.1	0.952	Contact Map
4rvcA	4	0.8115	6	0.952	Contact Map
3jqoB	3	0.7459	6	0.952	Contact Map
1vplA	2	0.7869	5.8	0.953	Contact Map
2i3bA	1	0.5492	5.8	0.953	Contact Map
4okuA	2	0.7213	4.8	0.954	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.006 seconds.