YJBK - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YJBK - Putative triphosphatase YjbK

UniProt:	O31609	Sequences: MSQEIEIEFKNMLTKQEFKNIASALQLTEKDFTDQKNHYFDTDSFALKQKHAALRIRRKNGKYVLTLKEPADVGLLETHQQLSEVSDLAGFSVPEGPVKDQLHKLQIDTDAIQYFGSLATNRAEKETEKGLIVLDHSRYLNKEDYEIEFEAADWHEGRQAFEKLLQQFSIPQRETKNKILRFYEEKRKSI	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	190 (185)
Sequences:	416 (349)
Seq/√Len:	25.6

BACSU - YJBK

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
136_H	143_E	4.953	1.00
116_G	182_F	4.685	1.00
17_E	173_R	4.521	1.00
80_Q	96_G	4.253	1.00
64_V	79_H	4.215	1.00
176_K	184_E	3.789	1.00
32_F	123_A	3.073	1.00
140_L	185_E	2.958	1.00
15_K	19_K	2.910	1.00
157_G	161_F	2.904	1.00
11_N	170_I	2.857	1.00
4_E	79_H	2.781	0.99
11_N	133_V	2.326	0.98
118_L	139_Y	2.307	0.98
75_L	177_N	2.152	0.97
115_F	183_Y	2.124	0.97
18_F	32_F	2.056	0.96
24_A	168_F	1.965	0.95
9_F	161_F	1.926	0.94
9_F	154_W	1.907	0.94
124_E	131_L	1.890	0.94
118_L	137_S	1.836	0.93
36_K	119_A	1.799	0.92
11_N	173_R	1.741	0.90
9_F	157_G	1.702	0.89
124_E	133_V	1.695	0.89
151_A	157_G	1.673	0.88
10_K	146_E	1.667	0.88
164_L	168_F	1.587	0.86
11_N	172_Q	1.584	0.86
38_H	117_S	1.552	0.84
158_R	162_E	1.549	0.84
69_E	78_T	1.507	0.83
151_A	161_F	1.493	0.82
27_L	123_A	1.439	0.79
138_R	143_E	1.431	0.79
69_E	101_Q	1.418	0.78
4_E	64_V	1.418	0.78
18_F	163_K	1.417	0.78
11_N	17_E	1.411	0.78
140_L	182_F	1.407	0.78
14_T	17_E	1.396	0.77
121_N	136_H	1.385	0.77
127_T	132_I	1.348	0.75
165_L	170_I	1.307	0.72
53_A	179_I	1.301	0.72
130_G	149_F	1.294	0.72
18_F	123_A	1.293	0.72
80_Q	94_P	1.291	0.71
58_R	63_Y	1.279	0.71
65_L	80_Q	1.278	0.71
180_L	184_E	1.276	0.71
59_K	63_Y	1.262	0.70
133_V	157_G	1.255	0.69
9_F	151_A	1.247	0.69
24_A	93_V	1.235	0.68
58_R	61_G	1.233	0.68
65_L	98_V	1.222	0.67
52_A	67_L	1.212	0.67
20_N	51_H	1.195	0.65
43_D	113_Q	1.193	0.65
18_F	22_A	1.186	0.65
5_I	71_A	1.158	0.63
21_I	168_F	1.157	0.63
36_K	117_S	1.148	0.62
115_F	182_F	1.121	0.60
132_I	164_L	1.117	0.60
13_L	17_E	1.116	0.60
64_V	151_A	1.115	0.60
120_T	144_D	1.109	0.59
149_F	161_F	1.107	0.59
82_L	86_S	1.103	0.59
11_N	175_T	1.098	0.59
41_D	140_L	1.083	0.58
172_Q	175_T	1.083	0.58
45_F	182_F	1.077	0.57
74_G	151_A	1.070	0.57
45_F	116_G	1.070	0.57
177_N	186_K	1.067	0.56
12_M	176_K	1.065	0.56
66_T	77_E	1.059	0.56
53_A	80_Q	1.058	0.56
27_L	32_F	1.056	0.56
178_K	181_R	1.056	0.56
53_A	79_H	1.038	0.54
53_A	59_K	1.031	0.54
40_F	78_T	1.029	0.54
124_E	165_L	1.029	0.54
53_A	177_N	1.027	0.54
13_L	134_L	1.023	0.53
56_I	87_D	1.023	0.53
34_D	121_N	1.010	0.52
80_Q	98_V	0.977	0.50
176_K	180_L	0.959	0.49
53_A	133_V	0.957	0.48
133_V	149_F	0.936	0.47
117_S	180_L	0.936	0.47
83_S	106_Q	0.931	0.47
38_H	114_Y	0.916	0.45
98_V	101_Q	0.914	0.45
40_F	114_Y	0.907	0.45
7_I	124_E	0.907	0.45
98_V	105_L	0.907	0.45
18_F	40_F	0.898	0.44
63_Y	149_F	0.894	0.44
69_E	79_H	0.890	0.44
140_L	186_K	0.888	0.43
70_P	124_E	0.887	0.43
31_D	34_D	0.886	0.43
60_N	63_Y	0.883	0.43
134_L	149_F	0.876	0.43
104_K	110_D	0.873	0.42
7_I	157_G	0.871	0.42
73_V	168_F	0.861	0.41
25_L	127_T	0.858	0.41
116_G	140_L	0.851	0.41
43_D	169_S	0.844	0.40
70_P	74_G	0.842	0.40
180_L	183_Y	0.838	0.40
16_Q	89_A	0.837	0.40
45_F	48_K	0.830	0.39
83_S	159_Q	0.830	0.39
7_I	74_G	0.820	0.39
42_T	165_L	0.818	0.38
161_F	165_L	0.814	0.38
42_T	56_I	0.813	0.38
13_L	147_I	0.807	0.38
128_E	160_A	0.804	0.37
65_L	96_G	0.802	0.37
129_K	160_A	0.793	0.37
48_K	183_Y	0.787	0.36
16_Q	20_N	0.783	0.36
103_H	108_D	0.783	0.36
64_V	131_L	0.782	0.36
53_A	75_L	0.782	0.36
153_D	164_L	0.778	0.36
133_V	172_Q	0.776	0.36
98_V	102_L	0.767	0.35
9_F	133_V	0.759	0.34
97_P	100_D	0.759	0.34
17_E	170_I	0.758	0.34
52_A	69_E	0.758	0.34
3_Q	76_L	0.757	0.34
59_K	79_H	0.755	0.34
153_D	158_R	0.755	0.34
153_D	157_G	0.751	0.34
159_Q	163_K	0.751	0.34
100_D	110_D	0.750	0.34
15_K	113_Q	0.747	0.34
18_F	21_I	0.743	0.33
4_E	11_N	0.736	0.33
48_K	51_H	0.735	0.33
128_E	163_K	0.732	0.33
26_Q	132_I	0.727	0.32
18_F	95_E	0.725	0.32
44_S	111_A	0.722	0.32
35_Q	112_I	0.722	0.32
12_M	172_Q	0.720	0.32
11_N	171_P	0.719	0.32
78_T	179_I	0.712	0.31
59_K	133_V	0.710	0.31
20_N	107_I	0.710	0.31
134_L	147_I	0.705	0.31
13_L	18_F	0.700	0.31
41_D	115_F	0.700	0.31
41_D	130_G	0.700	0.31
101_Q	104_K	0.696	0.30
133_V	151_A	0.696	0.30
74_G	118_L	0.690	0.30
88_L	169_S	0.685	0.30
17_E	175_T	0.682	0.30
25_L	170_I	0.680	0.29
70_P	177_N	0.678	0.29
49_Q	84_E	0.676	0.29
14_T	43_D	0.672	0.29
12_M	162_E	0.670	0.29
62_K	145_Y	0.670	0.29
111_A	145_Y	0.663	0.28
172_Q	179_I	0.662	0.28
53_A	124_E	0.655	0.28
7_I	118_L	0.654	0.28
11_N	165_L	0.654	0.28
43_D	95_E	0.652	0.28
60_N	87_D	0.646	0.27
153_D	159_Q	0.643	0.27
59_K	74_G	0.642	0.27
98_V	158_R	0.642	0.27
126_E	132_I	0.641	0.27
30_K	164_L	0.640	0.27
84_E	100_D	0.638	0.27
129_K	149_F	0.636	0.27
3_Q	78_T	0.633	0.27
140_L	143_E	0.633	0.27
75_L	164_L	0.632	0.27
170_I	175_T	0.631	0.26
38_H	58_R	0.630	0.26
17_E	147_I	0.624	0.26
100_D	158_R	0.617	0.26
152_A	166_Q	0.617	0.26
34_D	119_A	0.617	0.26
78_T	137_S	0.616	0.26
149_F	160_A	0.614	0.26
67_L	124_E	0.614	0.26
108_D	111_A	0.613	0.25
40_F	112_I	0.610	0.25
18_F	171_P	0.609	0.25
52_A	124_E	0.608	0.25
93_V	108_D	0.608	0.25
137_S	177_N	0.607	0.25
130_G	151_A	0.604	0.25
29_E	141_N	0.603	0.25
61_G	155_H	0.602	0.25
99_K	145_Y	0.599	0.25
11_N	157_G	0.594	0.24
139_Y	177_N	0.587	0.24
44_S	108_D	0.584	0.24
46_A	166_Q	0.583	0.24
40_F	69_E	0.582	0.24
83_S	87_D	0.581	0.24
7_I	66_T	0.580	0.24
71_A	76_L	0.580	0.24
71_A	186_K	0.577	0.24
19_K	22_A	0.575	0.23
80_Q	130_G	0.572	0.23
156_E	160_A	0.568	0.23
65_L	115_F	0.567	0.23
146_E	178_K	0.565	0.23
10_K	178_K	0.565	0.23
52_A	133_V	0.563	0.23
129_K	185_E	0.563	0.23
64_V	71_A	0.560	0.23
23_S	109_T	0.559	0.23
35_Q	42_T	0.558	0.23
15_K	143_E	0.557	0.22
166_Q	169_S	0.556	0.22
14_T	159_Q	0.555	0.22
12_M	171_P	0.554	0.22
29_E	111_A	0.550	0.22
29_E	153_D	0.545	0.22
59_K	114_Y	0.544	0.22
146_E	181_R	0.544	0.22
10_K	181_R	0.544	0.22
112_I	183_Y	0.542	0.22
119_A	145_Y	0.541	0.22
41_D	131_L	0.540	0.22
12_M	61_G	0.538	0.22
52_A	134_L	0.536	0.21
74_G	124_E	0.534	0.21
71_A	79_H	0.531	0.21
51_H	169_S	0.530	0.21
27_L	31_D	0.528	0.21
27_L	174_E	0.527	0.21
142_K	185_E	0.527	0.21
7_I	79_H	0.524	0.21
95_E	167_Q	0.523	0.21
90_G	95_E	0.522	0.21
52_A	78_T	0.522	0.21
84_E	145_Y	0.521	0.21
153_D	161_F	0.520	0.21
100_D	169_S	0.520	0.21
134_L	164_L	0.518	0.21
46_A	168_F	0.518	0.21
19_K	163_K	0.517	0.21
96_G	106_Q	0.516	0.20
7_I	161_F	0.515	0.20
147_I	158_R	0.514	0.20
45_F	118_L	0.512	0.20
81_Q	163_K	0.511	0.20
23_S	34_D	0.509	0.20
54_L	112_I	0.508	0.20
170_I	173_R	0.507	0.20
9_F	153_D	0.506	0.20
115_F	140_L	0.506	0.20
9_F	131_L	0.505	0.20
153_D	162_E	0.504	0.20
154_W	158_R	0.503	0.20
100_D	104_K	0.503	0.20
30_K	51_H	0.500	0.20

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
2gfgA	2	0.9842	100	0.474	Contact Map
3tj7A	2	0.9105	100	0.497	Contact Map
5a67A	1	0.9789	100	0.545	Contact Map
3bhdA	1	0.9368	100	0.584	Contact Map
2eenA	2	0.8842	99.9	0.63	Contact Map
2acaA	2	0.8579	99.9	0.633	Contact Map
3n10A	2	0.8632	99.9	0.634	Contact Map
5a61A	1	0.9526	99.9	0.646	Contact Map
2dc4A	2	0.8421	99.9	0.654	Contact Map
1yemA	2	0.8526	99.8	0.68	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0073 seconds.