TRHBO - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

TRHBO - Group 2 truncated hemoglobin YjbI

UniProt:	O31607	Sequences: MGQSFNAPYEAIGEELLSQLVDTFYERVASHPLLKPIFPSDLTETARKQKQFLTQYLGGPPLYTEEHGHPMLRARHLPFPITNERADAWLSCMKDAMDHVGLEGEIREFLFGRLELTARHMVNQTEAEDRSS	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	132 (119)
Sequences:	1893 (1227)
Seq/√Len:	112.5

BACSU - TRHBO

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
82_T	85_R	4.378	1.00
22_D	46_A	3.946	1.00
23_T	99_H	2.883	1.00
94_K	111_F	2.616	1.00
23_T	27_R	2.598	1.00
11_A	109_F	2.532	1.00
27_R	95_D	2.521	1.00
23_T	26_E	2.451	1.00
71_M	74_A	2.239	1.00
18_S	50_K	2.176	1.00
47_R	51_Q	2.074	1.00
26_E	46_A	1.924	1.00
14_E	18_S	1.913	1.00
21_V	53_L	1.898	1.00
27_R	99_H	1.829	1.00
14_E	50_K	1.828	1.00
14_E	54_T	1.760	1.00
51_Q	66_E	1.730	1.00
110_L	114_L	1.715	1.00
47_R	66_E	1.683	1.00
8_P	57_L	1.678	1.00
51_Q	67_H	1.616	1.00
61_P	65_E	1.610	1.00
20_L	100_V	1.607	1.00
88_A	92_C	1.571	1.00
103_E	106_I	1.559	1.00
16_L	19_Q	1.543	1.00
11_A	106_I	1.541	1.00
98_D	107_R	1.521	1.00
33_L	36_P	1.489	1.00
29_A	42_L	1.464	1.00
86_A	119_R	1.443	1.00
9_Y	54_T	1.420	1.00
33_L	84_E	1.406	1.00
37_I	85_R	1.403	1.00
9_Y	60_P	1.367	1.00
33_L	91_S	1.263	0.99
97_M	110_L	1.260	0.99
34_L	89_W	1.227	0.99
119_R	122_V	1.221	0.99
18_S	47_R	1.217	0.99
98_D	104_G	1.210	0.99
80_P	124_Q	1.187	0.99
22_D	26_E	1.153	0.99
23_T	100_V	1.152	0.99
72_L	117_T	1.152	0.99
31_H	91_S	1.124	0.98
104_G	108_E	1.120	0.98
46_A	50_K	1.114	0.98
48_K	67_H	1.099	0.98
70_P	75_R	1.094	0.98
51_Q	54_T	1.078	0.98
29_A	35_K	1.055	0.98
20_L	96_A	1.042	0.97
15_E	19_Q	1.035	0.97
6_N	10_E	1.027	0.97
74_A	77_L	1.025	0.97
6_N	11_A	1.017	0.97
8_P	106_I	1.015	0.97
108_E	112_G	1.012	0.97
50_K	54_T	1.000	0.97
33_L	88_A	0.999	0.97
83_N	118_A	0.998	0.97
91_S	95_D	0.981	0.96
27_R	92_C	0.975	0.96
17_L	57_L	0.975	0.96
24_F	28_V	0.972	0.96
34_L	85_R	0.961	0.96
54_T	62_L	0.957	0.96
96_A	100_V	0.938	0.95
12_I	16_L	0.927	0.95
97_M	107_R	0.927	0.95
57_L	114_L	0.922	0.95
18_S	22_D	0.919	0.95
71_M	75_R	0.917	0.95
9_Y	14_E	0.905	0.94
57_L	110_L	0.883	0.94
24_F	93_M	0.865	0.93
108_E	111_F	0.852	0.92
55_Q	64_T	0.850	0.92
109_F	112_G	0.849	0.92
81_I	85_R	0.847	0.92
35_K	42_L	0.824	0.91
33_L	92_C	0.800	0.90
94_K	107_R	0.788	0.89
70_P	73_R	0.786	0.89
84_E	88_A	0.767	0.88
8_P	12_I	0.755	0.87
93_M	114_L	0.754	0.87
51_Q	62_L	0.753	0.87
114_L	117_T	0.753	0.87
64_T	69_H	0.752	0.87
16_L	100_V	0.748	0.86
95_D	99_H	0.747	0.86
83_N	122_V	0.739	0.86
94_K	98_D	0.738	0.86
31_H	92_C	0.735	0.85
23_T	96_A	0.734	0.85
86_A	122_V	0.734	0.85
28_V	38_F	0.733	0.85
90_L	114_L	0.717	0.84
28_V	36_P	0.716	0.84
82_T	124_Q	0.711	0.84
31_H	88_A	0.710	0.83
34_L	88_A	0.703	0.83
20_L	93_M	0.689	0.82
73_R	120_H	0.687	0.81
90_L	111_F	0.674	0.80
75_R	79_F	0.666	0.79
81_I	122_V	0.660	0.79
28_V	56_Y	0.659	0.79
92_C	95_D	0.656	0.78
38_F	49_Q	0.652	0.78
29_A	46_A	0.650	0.78
15_E	18_S	0.648	0.78
115_E	118_A	0.643	0.77
104_G	107_R	0.640	0.77
28_V	49_Q	0.639	0.77
63_Y	69_H	0.630	0.76
8_P	109_F	0.629	0.75
111_F	115_E	0.628	0.75
97_M	102_L	0.624	0.75
25_Y	49_Q	0.623	0.75
29_A	43_T	0.623	0.75
42_L	46_A	0.622	0.75
7_A	10_E	0.615	0.74
11_A	105_E	0.614	0.74
115_E	119_R	0.610	0.73
73_R	123_N	0.610	0.73
47_R	50_K	0.609	0.73
45_T	48_K	0.604	0.72
25_Y	52_F	0.603	0.72
69_H	73_R	0.601	0.72
44_E	48_K	0.599	0.72
89_W	93_M	0.596	0.71
42_L	45_T	0.594	0.71
39_P	45_T	0.594	0.71
90_L	115_E	0.592	0.71
37_I	49_Q	0.588	0.70
27_R	96_A	0.587	0.70
102_L	105_E	0.586	0.70
44_E	47_R	0.585	0.70
69_H	72_L	0.584	0.70
62_L	65_E	0.584	0.70
12_I	100_V	0.581	0.70
18_S	46_A	0.580	0.69
14_E	62_L	0.579	0.69
108_E	115_E	0.573	0.68
98_D	111_F	0.572	0.68
8_P	110_L	0.567	0.68
12_I	106_I	0.565	0.67
34_L	37_I	0.564	0.67
48_K	55_Q	0.552	0.66
34_L	81_I	0.546	0.65
24_F	89_W	0.543	0.64
75_R	121_M	0.542	0.64
19_Q	101_G	0.542	0.64
38_F	56_Y	0.538	0.64
116_L	120_H	0.538	0.64
85_R	122_V	0.537	0.64
12_I	57_L	0.536	0.63
82_T	122_V	0.534	0.63
97_M	100_V	0.533	0.63
36_P	85_R	0.531	0.63
30_S	40_S	0.527	0.62
19_Q	23_T	0.527	0.62
55_Q	122_V	0.526	0.62
12_I	17_L	0.526	0.62
6_N	61_P	0.524	0.62
121_M	124_Q	0.519	0.61
10_E	36_P	0.518	0.61
105_E	108_E	0.510	0.60
11_A	103_E	0.507	0.59
16_L	97_M	0.506	0.59
23_T	95_D	0.504	0.59
61_P	64_T	0.502	0.58
94_K	115_E	0.501	0.58
12_I	116_L	0.500	0.58

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
4nk2A	2	0.9924	100	0.205	Contact Map
4c0nA	2	0.9697	100	0.219	Contact Map
4uurA	1	0.9091	100	0.226	Contact Map
2xykA	1	0.9545	100	0.263	Contact Map
1ux8A	1	0.8939	100	0.263	Contact Map
4uzvA	2	0.9621	100	0.266	Contact Map
2bmmA	1	0.9167	100	0.291	Contact Map
2bkmA	1	0.9621	100	0.292	Contact Map
1dlyA	1	0.8864	100	0.295	Contact Map
3aq9A	1	0.8712	100	0.307	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0059 seconds.