YHZB - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YHZB - Uncharacterized protein YhzB

UniProt:	O31588	Sequences: MNIKLDSVITERAAGLHAAAVIYENIEVGSSPQMLKGRLRLFQESLFFDYADGGISDESFVKEWQKLFKQLNPSFEGETTPMEDMLVPISKEQFMESKDSAHDTIDFFALKYSLPIMIYDAGKLHEPVRISLGEKENILLFSDENGIFGDFKNSVNHYPVSNETKNMLQIIFFPPSIEKSSAVNLLSSLTKMFEQIHGGTHTVHWLT	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	207 (197)
Sequences:	1020 (716)
Seq/√Len:	51.0

BACSU - YHZB
SULSO - Q7LXP7

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
122_G	166_N	8.733	1.00
131_S	142_S	4.874	1.00
125_H	145_N	4.390	1.00
111_K	188_S	4.169	1.00
19_A	186_L	3.652	1.00
156_N	159_P	3.396	1.00
146_G	157_H	3.040	1.00
65_Q	83_E	3.009	1.00
118_I	160_V	2.917	1.00
108_F	188_S	2.855	1.00
81_P	117_M	2.779	1.00
128_V	148_F	2.602	1.00
191_K	195_Q	2.501	1.00
62_K	66_K	2.414	1.00
129_R	144_E	2.312	1.00
79_T	87_V	2.247	1.00
89_I	110_L	2.182	1.00
7_S	11_E	2.123	1.00
17_H	182_A	2.057	1.00
73_P	138_I	2.050	1.00
44_E	48_F	1.997	1.00
105_I	118_I	1.994	1.00
24_E	166_N	1.986	1.00
101_A	167_M	1.980	1.00
141_F	172_F	1.875	0.99
180_S	184_N	1.856	0.99
125_H	144_E	1.753	0.99
132_L	139_L	1.743	0.99
120_D	123_K	1.740	0.99
187_S	191_K	1.730	0.99
37_G	41_L	1.714	0.99
126_E	144_E	1.699	0.99
6_D	129_R	1.690	0.99
143_D	146_G	1.616	0.98
133_G	140_L	1.602	0.98
108_F	185_L	1.577	0.98
120_D	164_T	1.559	0.97
23_Y	193_F	1.509	0.97
183_V	187_S	1.500	0.97
45_S	111_K	1.488	0.97
127_P	144_E	1.487	0.97
33_Q	37_G	1.474	0.96
181_S	184_N	1.457	0.96
69_K	76_E	1.455	0.96
108_F	189_L	1.454	0.96
81_P	149_G	1.445	0.96
178_E	181_S	1.440	0.96
138_I	152_K	1.424	0.96
112_Y	185_L	1.407	0.95
75_F	87_V	1.397	0.95
4_K	191_K	1.378	0.95
164_T	167_M	1.325	0.94
119_Y	149_G	1.324	0.94
124_L	148_F	1.321	0.93
54_G	57_D	1.307	0.93
117_M	149_G	1.271	0.92
119_Y	172_F	1.268	0.92
105_I	149_G	1.257	0.92
179_K	183_V	1.246	0.91
66_K	70_Q	1.234	0.91
40_R	43_Q	1.230	0.91
32_P	100_S	1.225	0.91
12_R	132_L	1.210	0.90
7_S	10_T	1.205	0.90
15_G	176_S	1.197	0.90
17_H	179_K	1.195	0.89
112_Y	188_S	1.184	0.89
108_F	192_M	1.137	0.87
105_I	172_F	1.114	0.86
188_S	192_M	1.111	0.86
22_I	121_A	1.103	0.85
5_L	10_T	1.101	0.85
34_M	37_G	1.079	0.84
79_T	154_S	1.068	0.83
7_S	33_Q	1.067	0.83
34_M	195_Q	1.064	0.83
101_A	193_F	1.051	0.82
163_E	191_K	1.047	0.82
55_I	90_S	1.034	0.81
119_Y	151_F	1.029	0.81
73_P	77_G	1.027	0.81
130_I	141_F	1.022	0.81
124_L	158_Y	1.014	0.80
173_F	182_A	1.009	0.80
123_K	161_S	1.002	0.79
74_S	77_G	1.002	0.79
9_I	16_L	0.995	0.79
138_I	150_D	0.992	0.79
119_Y	141_F	0.973	0.77
47_F	94_F	0.971	0.77
88_P	154_S	0.968	0.77
64_W	172_F	0.968	0.77
189_L	193_F	0.960	0.76
118_I	158_Y	0.954	0.76
15_G	70_Q	0.933	0.74
118_I	130_I	0.922	0.73
36_K	97_S	0.921	0.73
124_L	127_P	0.917	0.73
192_M	196_I	0.917	0.73
21_V	190_T	0.910	0.72
72_N	75_F	0.908	0.72
64_W	115_P	0.905	0.72
65_Q	76_E	0.898	0.71
73_P	152_K	0.883	0.70
51_A	54_G	0.882	0.70
45_S	48_F	0.875	0.69
28_V	159_P	0.873	0.69
43_Q	95_M	0.872	0.69
57_D	134_E	0.872	0.69
145_N	163_E	0.865	0.68
188_S	191_K	0.862	0.68
25_N	166_N	0.860	0.68
23_Y	169_Q	0.855	0.67
20_A	168_L	0.852	0.67
64_W	139_L	0.850	0.67
64_W	153_N	0.842	0.66
42_F	107_F	0.838	0.66
121_A	124_L	0.830	0.65
84_D	171_I	0.826	0.65
106_D	109_A	0.824	0.65
58_E	113_S	0.808	0.63
28_V	101_A	0.806	0.63
149_G	172_F	0.806	0.63
99_D	162_N	0.804	0.63
74_S	149_G	0.802	0.62
84_D	88_P	0.801	0.62
61_V	65_Q	0.801	0.62
105_I	151_F	0.800	0.62
138_I	153_N	0.796	0.62
124_L	168_L	0.790	0.61
26_I	167_M	0.779	0.60
74_S	80_T	0.779	0.60
64_W	151_F	0.776	0.60
76_E	82_M	0.775	0.60
22_I	166_N	0.774	0.60
119_Y	154_S	0.770	0.59
111_K	192_M	0.764	0.59
33_Q	41_L	0.762	0.58
106_D	117_M	0.762	0.58
65_Q	79_T	0.759	0.58
75_F	88_P	0.758	0.58
5_L	18_A	0.744	0.57
85_M	109_A	0.743	0.57
61_V	86_L	0.738	0.56
150_D	172_F	0.736	0.56
190_T	194_E	0.733	0.56
46_L	107_F	0.732	0.55
17_H	173_F	0.729	0.55
81_P	109_A	0.725	0.55
86_L	110_L	0.724	0.55
4_K	45_S	0.719	0.54
84_D	149_G	0.718	0.54
45_S	110_L	0.710	0.53
29_G	163_E	0.710	0.53
190_T	199_G	0.709	0.53
71_L	151_F	0.708	0.53
66_K	69_K	0.707	0.53
133_G	139_L	0.702	0.52
35_L	196_I	0.702	0.52
34_M	196_I	0.690	0.51
80_T	83_E	0.690	0.51
68_F	151_F	0.690	0.51
7_S	134_E	0.689	0.51
116_I	119_Y	0.688	0.51
37_G	70_Q	0.685	0.51
153_N	172_F	0.683	0.50
28_V	162_N	0.682	0.50
88_P	106_D	0.681	0.50
105_I	119_Y	0.677	0.50
138_I	154_S	0.676	0.50
149_G	153_N	0.674	0.49
171_I	185_L	0.673	0.49
118_I	133_G	0.673	0.49
72_N	77_G	0.672	0.49
6_D	131_S	0.670	0.49
151_F	154_S	0.670	0.49
130_I	135_K	0.667	0.49
101_A	164_T	0.664	0.48
16_L	155_V	0.662	0.48
193_F	199_G	0.661	0.48
138_I	172_F	0.661	0.48
64_W	73_P	0.658	0.48
128_V	188_S	0.658	0.48
11_E	132_L	0.657	0.48
135_K	149_G	0.656	0.48
81_P	110_L	0.653	0.47
126_E	143_D	0.653	0.47
151_F	172_F	0.652	0.47
82_M	138_I	0.649	0.47
79_T	84_D	0.647	0.47
82_M	152_K	0.646	0.47
3_I	168_L	0.641	0.46
55_I	86_L	0.640	0.46
155_V	170_I	0.640	0.46
41_L	45_S	0.639	0.46
118_I	121_A	0.634	0.45
44_E	162_N	0.630	0.45
76_E	150_D	0.628	0.45
37_G	48_F	0.628	0.45
12_R	70_Q	0.626	0.45
148_F	154_S	0.625	0.44
81_P	84_D	0.623	0.44
37_G	180_S	0.623	0.44
50_Y	86_L	0.620	0.44
84_D	153_N	0.620	0.44
44_E	47_F	0.620	0.44
193_F	198_G	0.620	0.44
41_L	44_E	0.619	0.44
45_S	49_D	0.617	0.44
47_F	92_E	0.615	0.43
76_E	152_K	0.611	0.43
11_E	44_E	0.611	0.43
177_I	181_S	0.610	0.43
25_N	165_K	0.610	0.43
122_G	165_K	0.609	0.43
52_D	134_E	0.609	0.43
59_S	187_S	0.608	0.43
145_N	180_S	0.602	0.42
28_V	100_S	0.601	0.42
151_F	158_Y	0.601	0.42
105_I	155_V	0.600	0.42
43_Q	97_S	0.600	0.42
29_G	165_K	0.599	0.42
149_G	158_Y	0.598	0.42
50_Y	58_E	0.598	0.42
64_W	96_E	0.597	0.42
184_N	194_E	0.597	0.42
90_S	94_F	0.593	0.41
72_N	87_V	0.593	0.41
130_I	174_P	0.592	0.41
40_R	194_E	0.585	0.40
6_D	60_F	0.581	0.40
74_S	151_F	0.579	0.40
100_S	197_H	0.578	0.40
169_Q	189_L	0.578	0.40
87_V	151_F	0.577	0.40
36_K	40_R	0.577	0.40
119_Y	155_V	0.573	0.39
115_P	172_F	0.570	0.39
26_I	123_K	0.569	0.39
9_I	139_L	0.568	0.39
70_Q	129_R	0.568	0.39
84_D	117_M	0.565	0.38
147_I	157_H	0.564	0.38
108_F	193_F	0.564	0.38
134_E	191_K	0.563	0.38
27_E	165_K	0.561	0.38
143_D	157_H	0.561	0.38
19_A	182_A	0.559	0.38
76_E	91_K	0.559	0.38
125_H	191_K	0.557	0.38
153_N	174_P	0.555	0.37
119_Y	152_K	0.554	0.37
33_Q	36_K	0.554	0.37
141_F	170_I	0.552	0.37
86_L	90_S	0.548	0.37
78_E	104_T	0.548	0.37
69_K	157_H	0.547	0.37
61_V	82_M	0.545	0.36
114_L	171_I	0.545	0.36
13_A	71_L	0.544	0.36
84_D	87_V	0.543	0.36
18_A	141_F	0.542	0.36
69_K	74_S	0.542	0.36
68_F	75_F	0.541	0.36
141_F	151_F	0.541	0.36
18_A	166_N	0.539	0.36
80_T	113_S	0.539	0.36
173_F	179_K	0.538	0.36
61_V	95_M	0.538	0.36
119_Y	150_D	0.536	0.36
35_L	107_F	0.536	0.36
105_I	169_Q	0.534	0.35
119_Y	148_F	0.531	0.35
103_D	164_T	0.530	0.35
44_E	193_F	0.528	0.35
105_I	153_N	0.527	0.35
81_P	88_P	0.524	0.34
26_I	195_Q	0.523	0.34
30_S	100_S	0.523	0.34
80_T	151_F	0.522	0.34
105_I	141_F	0.522	0.34
27_E	100_S	0.520	0.34
68_F	197_H	0.520	0.34
32_P	199_G	0.520	0.34
128_V	131_S	0.517	0.34
33_Q	184_N	0.517	0.34
126_E	157_H	0.517	0.34
133_G	138_I	0.517	0.34
45_S	190_T	0.510	0.33
31_S	100_S	0.507	0.33
94_F	180_S	0.505	0.33
89_I	119_Y	0.502	0.32
187_S	190_T	0.501	0.32
37_G	44_E	0.500	0.32
69_K	77_G	0.500	0.32

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
1b7yB	2	0.9807	99.9	0.675	Contact Map
2rhqB	2	0.9952	99.9	0.683	Contact Map
3pcoB	2	0.9807	99.9	0.688	Contact Map
4p72A	2	0.9952	99.9	0.691	Contact Map
3l4gB	2	0.8116	99.2	0.805	Contact Map
2cxiA	3	0.6618	99.2	0.805	Contact Map
3enpA	2	0.6329	52	0.946	Contact Map
3a2kA	1	0.8213	28.9	0.953	Contact Map
4a5oA	2	0.8213	19.7	0.957	Contact Map
3mkbB	1	0.4541	18.3	0.957	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0076 seconds.