RS14B - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

RS14B - Alternate 30S ribosomal protein S14

UniProt:	O31587	Sequences: MAKKSKVAKELKRQQLVEQYAGIRRELKEKGDYEALSKLPRDSAPGRLHNRCMVTGRPRAYMRKFKMSRIAFRELAHKGQIPGVKKASW	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	89 (89)
Sequences:	1631 (633)
Seq/√Len:	67.1

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
8_A	11_L	3.394	1.00
49_H	59_R	3.378	1.00
52_C	55_T	3.041	1.00
50_N	61_Y	2.958	1.00
10_E	14_Q	2.933	1.00
17_V	48_L	2.425	1.00
62_M	72_F	2.410	1.00
11_L	14_Q	2.263	1.00
16_L	43_S	2.194	1.00
10_E	48_L	2.073	1.00
26_E	30_K	2.009	1.00
4_K	7_V	1.964	1.00
39_L	43_S	1.952	1.00
20_Y	43_S	1.852	1.00
72_F	84_V	1.829	1.00
76_A	84_V	1.802	1.00
81_I	84_V	1.723	1.00
14_Q	48_L	1.721	1.00
4_K	8_A	1.652	0.99
53_M	66_K	1.611	0.99
74_E	78_K	1.604	0.99
71_A	74_E	1.594	0.99
21_A	25_R	1.580	0.99
65_F	84_V	1.525	0.99
29_E	32_D	1.516	0.99
55_T	71_A	1.507	0.99
23_I	26_E	1.429	0.98
52_C	71_A	1.417	0.98
34_E	38_K	1.278	0.96
6_K	9_K	1.238	0.96
75_L	80_Q	1.214	0.95
18_E	21_A	1.167	0.94
10_E	13_R	1.153	0.94
41_R	46_G	1.149	0.93
25_R	29_E	1.132	0.93
22_G	26_E	1.090	0.92
9_K	12_K	1.088	0.91
35_A	39_L	1.079	0.91
32_D	35_A	1.062	0.90
14_Q	18_E	1.060	0.90
10_E	49_H	1.052	0.90
6_K	10_E	1.039	0.90
6_K	58_P	0.981	0.87
13_R	16_L	0.953	0.85
15_Q	19_Q	0.947	0.85
77_H	81_I	0.947	0.85
24_R	43_S	0.932	0.84
22_G	25_R	0.922	0.83
20_Y	39_L	0.919	0.83
67_M	71_A	0.907	0.82
16_L	44_A	0.900	0.82
39_L	45_P	0.849	0.78
9_K	13_R	0.809	0.74
49_H	58_P	0.801	0.73
27_L	82_P	0.797	0.73
75_L	78_K	0.784	0.72
55_T	68_S	0.777	0.71
20_Y	40_P	0.772	0.71
30_K	33_Y	0.772	0.71
13_R	42_D	0.768	0.70
55_T	74_E	0.767	0.70
54_V	59_R	0.766	0.70
33_Y	43_S	0.734	0.67
14_Q	50_N	0.731	0.66
59_R	64_K	0.729	0.66
3_K	6_K	0.725	0.66
10_E	17_V	0.725	0.66
28_K	36_L	0.723	0.66
28_K	31_G	0.717	0.65
30_K	35_A	0.712	0.64
77_H	80_Q	0.709	0.64
49_H	61_Y	0.695	0.62
40_P	43_S	0.687	0.62
54_V	67_M	0.687	0.62
50_N	63_R	0.681	0.61
65_F	72_F	0.671	0.60
18_E	22_G	0.666	0.59
68_S	71_A	0.662	0.59
63_R	72_F	0.662	0.59
76_A	81_I	0.658	0.58
28_K	32_D	0.654	0.58
35_A	42_D	0.648	0.57
35_A	38_K	0.644	0.57
38_K	45_P	0.642	0.56
34_E	37_S	0.641	0.56
50_N	60_A	0.641	0.56
59_R	77_H	0.641	0.56
34_E	81_I	0.639	0.56
23_I	30_K	0.638	0.56
28_K	33_Y	0.638	0.56
31_G	36_L	0.637	0.56
6_K	77_H	0.632	0.55
9_K	37_S	0.631	0.55
31_G	34_E	0.625	0.54
72_F	77_H	0.625	0.54
71_A	75_L	0.623	0.54
72_F	81_I	0.613	0.53
57_R	70_I	0.607	0.52
67_M	75_L	0.607	0.52
37_S	62_M	0.606	0.52
54_V	71_A	0.601	0.52
27_L	86_K	0.600	0.51
24_R	44_A	0.598	0.51
10_E	53_M	0.592	0.51
77_H	87_A	0.587	0.50
13_R	41_R	0.586	0.50
33_Y	37_S	0.582	0.49
8_A	15_Q	0.575	0.48
49_H	60_A	0.574	0.48
64_K	75_L	0.565	0.47
12_K	16_L	0.560	0.47
31_G	37_S	0.559	0.47
14_Q	59_R	0.557	0.46
71_A	77_H	0.548	0.45
60_A	71_A	0.546	0.45
1_M	5_S	0.545	0.45
31_G	35_A	0.544	0.45
51_R	58_P	0.542	0.45
11_L	63_R	0.542	0.45
23_I	38_K	0.538	0.44
37_S	67_M	0.538	0.44
37_S	46_G	0.538	0.44
33_Y	62_M	0.535	0.44
3_K	78_K	0.529	0.43
60_A	82_P	0.524	0.42
56_G	79_G	0.520	0.42
39_L	69_R	0.511	0.41
4_K	68_S	0.511	0.41
21_A	29_E	0.505	0.40
33_Y	85_K	0.505	0.40
70_I	74_E	0.504	0.40
3_K	9_K	0.501	0.40
72_F	76_A	0.501	0.40
50_N	53_M	0.500	0.40

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3bbnN	1	0.9888	100	0.145	Contact Map
4tp8N	1	0.9888	100	0.175	Contact Map
5aj3N	1	0.9775	100	0.247	Contact Map
4rb5N	1	0.6742	99.9	0.439	Contact Map
4w23d	1	0.5618	99.6	0.592	Contact Map
3j60d	1	0.5169	99.6	0.604	Contact Map
4ujpe	1	0.573	99.5	0.615	Contact Map
3j7aT	1	0.5169	99.5	0.619	Contact Map
3zey8	1	0.4494	99.4	0.632	Contact Map
4bpeN	1	0.5843	99.4	0.639	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0053 seconds.