YFHK - BACSU - GREMLIN Contacts

Home
GREMLIN
- Submit - Monomer
- Submit - Complex
Contacts
Metagenomics
- Contacts
- Structures
Structures
- List
Old Projects
- Complexes (2014)
- PFAM (2013)

YFHK - Uncharacterized protein YfhK

UniProt:	O31579	Sequences: MKKKQVMLALTAAAGLGLTALHSAPAAKAAPLHDISVSMPSSDTYIIKAGKLNVRTEPNHEGDILGTVSSEQKVKVDRFVNADWAQIHFKGKKAYISTHFLMKTASQAKTTKQTAFYTPTPENGKAKQLSSGTEVTILGWGFSENGGFDFTWAFVDYGGVKGYIHTKDLQMR	Download Alignment We filter this alignment to remove sites that have many gaps before running GREMLIN. Date: 2015_01
Length:	172 (139)
Sequences:	365 (325)
Seq/√Len:	27.6

BACSU - YFHK YWSB

GREMLIN Results:

Legend: The darker and larger the blue dots, the higher coevolution strength.

Residue pairs sorted by coevolution strength:

i	j	Sco	Prob
57_E	62_G	4.984	1.00
59_N	62_G	4.328	1.00
68_V	74_V	3.979	1.00
157_Y	166_T	2.882	1.00
154_F	159_G	2.710	1.00
157_Y	160_V	2.605	0.99
53_N	67_T	2.500	0.99
147_G	150_F	2.444	0.99
156_D	159_G	2.234	0.98
86_Q	93_K	2.220	0.98
74_V	87_I	2.191	0.98
142_F	145_N	2.179	0.98
155_V	160_V	2.166	0.98
160_V	166_T	2.126	0.97
52_L	100_F	2.071	0.97
148_F	157_Y	1.904	0.95
147_G	151_T	1.738	0.92
85_A	98_T	1.637	0.89
66_G	89_F	1.610	0.88
147_G	152_W	1.572	0.87
153_A	162_G	1.569	0.87
37_V	110_T	1.564	0.87
134_E	138_L	1.539	0.86
163_Y	167_K	1.518	0.85
147_G	153_A	1.478	0.84
76_V	101_L	1.447	0.82
148_F	151_T	1.445	0.82
155_V	165_H	1.441	0.82
47_I	52_L	1.439	0.82
87_I	94_A	1.434	0.82
56_T	63_D	1.407	0.81
140_W	154_F	1.386	0.80
143_S	148_F	1.385	0.79
76_V	85_A	1.381	0.79
111_T	119_P	1.367	0.79
31_P	35_I	1.313	0.76
144_E	156_D	1.296	0.75
85_A	101_L	1.289	0.74
148_F	160_V	1.289	0.74
157_Y	163_Y	1.287	0.74
140_W	170_Q	1.280	0.74
165_H	169_L	1.275	0.73
124_G	128_Q	1.266	0.73
144_E	148_F	1.242	0.71
149_D	153_A	1.241	0.71
45_Y	76_V	1.231	0.71
150_F	157_Y	1.224	0.70
155_V	159_G	1.186	0.68
135_V	139_G	1.153	0.66
147_G	161_K	1.131	0.64
152_W	161_K	1.131	0.64
57_E	95_Y	1.130	0.64
123_N	129_L	1.106	0.62
41_S	118_T	1.104	0.62
150_F	161_K	1.101	0.62
149_D	166_T	1.098	0.62
49_A	52_L	1.096	0.62
77_D	169_L	1.090	0.61
150_F	153_A	1.085	0.61
166_T	169_L	1.067	0.59
83_D	98_T	1.064	0.59
139_G	142_F	1.064	0.59
124_G	127_K	1.058	0.59
46_I	64_I	1.048	0.58
157_Y	165_H	1.037	0.57
95_Y	98_T	1.036	0.57
148_F	163_Y	1.024	0.56
148_F	156_D	1.023	0.56
65_L	70_S	1.008	0.55
74_V	101_L	1.001	0.55
143_S	151_T	0.994	0.54
45_Y	85_A	0.989	0.54
151_T	154_F	0.976	0.53
137_I	147_G	0.970	0.52
140_W	151_T	0.960	0.51
151_T	157_Y	0.958	0.51
134_E	143_S	0.955	0.51
151_T	162_G	0.951	0.51
147_G	154_F	0.944	0.50
152_W	155_V	0.940	0.50
125_K	129_L	0.938	0.50
31_P	34_D	0.929	0.49
34_D	59_N	0.901	0.47
89_F	101_L	0.898	0.47
127_K	131_S	0.887	0.46
149_D	160_V	0.884	0.46
152_W	159_G	0.878	0.45
149_D	164_I	0.874	0.45
144_E	163_Y	0.873	0.45
150_F	163_Y	0.873	0.45
143_S	149_D	0.871	0.45
96_I	101_L	0.862	0.44
96_I	99_H	0.860	0.44
149_D	152_W	0.857	0.44
147_G	157_Y	0.854	0.43
50_G	70_S	0.853	0.43
141_G	156_D	0.852	0.43
152_W	165_H	0.843	0.43
30_A	37_V	0.840	0.42
134_E	141_G	0.832	0.42
161_K	167_K	0.832	0.42
63_D	74_V	0.824	0.41
148_F	166_T	0.822	0.41
154_F	162_G	0.818	0.41
149_D	161_K	0.818	0.41
144_E	160_V	0.809	0.40
145_N	148_F	0.802	0.40
140_W	147_G	0.788	0.39
67_T	103_K	0.786	0.38
54_V	89_F	0.780	0.38
47_I	76_V	0.778	0.38
155_V	163_Y	0.771	0.37
76_V	103_K	0.768	0.37
129_L	132_G	0.760	0.37
83_D	99_H	0.751	0.36
124_G	130_S	0.746	0.36
144_E	147_G	0.746	0.36
138_L	145_N	0.731	0.35
144_E	150_F	0.730	0.34
128_Q	131_S	0.728	0.34
144_E	157_Y	0.723	0.34
52_L	83_D	0.718	0.34
130_S	133_T	0.715	0.33
147_G	163_Y	0.714	0.33
140_W	163_Y	0.713	0.33
123_N	126_A	0.712	0.33
161_K	164_I	0.708	0.33
151_T	161_K	0.707	0.33
117_Y	127_K	0.704	0.33
116_F	119_P	0.702	0.33
68_V	102_M	0.700	0.32
71_E	91_G	0.700	0.32
43_D	71_E	0.699	0.32
153_A	159_G	0.698	0.32
134_E	168_D	0.693	0.32
150_F	159_G	0.691	0.32
137_I	151_T	0.689	0.32
137_I	152_W	0.688	0.32
65_L	94_A	0.682	0.31
151_T	155_V	0.678	0.31
160_V	163_Y	0.676	0.31
54_V	98_T	0.674	0.31
157_Y	161_K	0.668	0.30
68_V	85_A	0.667	0.30
87_I	92_K	0.666	0.30
153_A	161_K	0.664	0.30
140_W	144_E	0.657	0.30
50_G	69_S	0.654	0.29
53_N	63_D	0.653	0.29
160_V	165_H	0.642	0.29
60_H	125_K	0.640	0.29
142_F	170_Q	0.635	0.28
33_H	37_V	0.632	0.28
52_L	97_S	0.631	0.28
48_K	102_M	0.631	0.28
66_G	74_V	0.629	0.28
91_G	116_F	0.628	0.28
42_S	91_G	0.624	0.28
143_S	156_D	0.623	0.28
55_R	64_I	0.623	0.28
140_W	148_F	0.613	0.27
117_Y	120_T	0.608	0.27
115_A	118_T	0.604	0.26
149_D	154_F	0.603	0.26
86_Q	95_Y	0.602	0.26
54_V	66_G	0.600	0.26
163_Y	166_T	0.591	0.26
98_T	114_T	0.588	0.25
157_Y	167_K	0.586	0.25
164_I	167_K	0.584	0.25
59_N	75_K	0.582	0.25
134_E	139_G	0.578	0.25
123_N	133_T	0.578	0.25
83_D	167_K	0.575	0.25
78_R	86_Q	0.574	0.25
77_D	138_L	0.573	0.25
143_S	147_G	0.571	0.24
41_S	94_A	0.568	0.24
150_F	154_F	0.568	0.24
145_N	151_T	0.563	0.24
148_F	155_V	0.561	0.24
105_A	113_Q	0.550	0.23
50_G	83_D	0.546	0.23
41_S	45_Y	0.543	0.23
66_G	90_K	0.541	0.23
128_Q	132_G	0.540	0.23
56_T	86_Q	0.540	0.23
106_S	121_P	0.539	0.23
39_M	42_S	0.535	0.23
145_N	149_D	0.533	0.22
157_Y	162_G	0.530	0.22
140_W	156_D	0.529	0.22
89_F	136_T	0.526	0.22
89_F	92_K	0.526	0.22
113_Q	117_Y	0.524	0.22
149_D	157_Y	0.520	0.22
35_I	39_M	0.518	0.22
152_W	170_Q	0.517	0.22
36_S	41_S	0.517	0.22
91_G	94_A	0.514	0.21
34_D	170_Q	0.514	0.21
51_K	69_S	0.513	0.21
56_T	62_G	0.509	0.21
145_N	153_A	0.508	0.21
67_T	131_S	0.504	0.21
148_F	154_F	0.504	0.21
162_G	166_T	0.504	0.21
46_I	125_K	0.500	0.21

Legend: The i and j are positions as given in the UniProt sequence. Only predictions with Prob ≥ 0.7 are listed. For all 3L/2 predictions, click on one of the links below.

Sco = ((raw_sco - min_sco)/(avg_sco - min_sco))/2 + 0.5
Prob = P(contact | Sco, seq80/√len)
seq80 = effective number of sequences, after reducing redundancy to 80% identity

Text file of predictions (all 3L/2 predictions)
Generate restraints for ROSETTA Structure Modeling
Upload PDB model overlay contacts on the model

HHsearch Results:

Legend: GREMLIN results (Prob ≥ 0.7) overlaid on top PDB hits. The grey/red filled circles underneath are pdb residue contacts (min distance < 5 Angstroms). The shade of the circles is based on the top 10 (or top 20 if e-value < 1E-20) HHsearch results which uses the overall probability and per-site alignment prob. Inter oligomeric contacts in the pdb are in shades of red.

PDB	Chains	Cov	%	HHΔ
3npfA	2	0.7965	99.7	0.555	Contact Map
3h41A	1	0.9302	99.6	0.59	Contact Map
3m1uA	2	0.9767	99.4	0.647	Contact Map
2kt8A	1	0.436	99.4	0.65	Contact Map
2hbwA	1	0.6919	99.4	0.65	Contact Map
2kq8A	1	0.407	99.4	0.654	Contact Map
2krsA	1	0.4244	99.3	0.664	Contact Map
4krtA	1	0.593	98.9	0.721	Contact Map
4q4gX	1	0.5988	97.5	0.805	Contact Map
4xcmA	2	0.7326	97.3	0.813	Contact Map

Sequence Conservation (Image Generated using WebLogo v3)

Legend: Color is used to show Hydrophobicity (Blue: Hydrophilic, Green: Neutral and Black: Hydrophobic). Amount of gaps is represented by width.

Page generated in 0.0062 seconds.